KEGG   Mycobacterium marinum: MMAR_2507Help
Entry
MMAR_2507         CDS       T00694                                 

Definition
O-methyltransferase
Orthology
K00545  
catechol O-methyltransferase [EC:2.1.1.6]
Organism
mmi  Mycobacterium marinum
Pathway
Tyrosine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmi00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    MMAR_2507
Enzymes [BR:mmi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.6  catechol O-methyltransferase
     MMAR_2507
Exosome [BR:mmi04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   MMAR_2507
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3051488..3052240)
Genome map
AA seq 250 aa AA seqDB search
MRLNARFAPLRWSVLRLALAFRTLLRTGQVGDGREAAAVDYVLEHARTGDIDDVLATIDK
FAYEKSILVNVGDEKGLLLDAAVRRADPALALELGTYCGYGALRIARAAPQAKVYSVELA
EANAANARQIWAHAGVADRVTCVVGTIGDGGRTLDALATEHGFAPGALDFVFVDHDKKAY
LDDLQSILDREWLHRGSIVVADNVKVPGAPEYHEYMRHHQGTLWDTTEHKTHLEYQTLVS
DLVLESDYLG
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgaggctcaacgcacgcttcgctccgttgcggtggtcggtattgcgcctggcactggca
tttcgcaccctgctcagaacgggccaggtcggcgacggccgcgaggccgcggccgtcgac
tatgtgctcgagcacgcccgcaccggcgatatcgacgacgtgctggccaccatcgacaag
ttcgcctacgaaaagtccatcctggtcaacgtcggcgacgagaaggggctgctactcgat
gccgcggtgcgacgcgccgatccggcactggcgctggaactgggcacctactgcgggtat
ggcgcgctgcggatcgcccgggccgcaccgcaggccaaggtgtactccgtcgaacttgcc
gaagccaacgccgccaacgcccgacagatctgggctcatgccggcgttgccgatcgcgtg
acatgtgtcgtgggcaccattggcgacggcggacgcaccctggacgcactcgcgaccgag
cacggattcgcccccggtgcgctcgatttcgtctttgtcgatcacgacaagaaggcctac
ctcgacgacctgcaaagcatcctggaccgggagtggctgcatcggggctcgatcgtggtg
gccgacaacgtcaaggtgcccggcgctcccgagtaccacgaatacatgcggcaccatcag
ggcacgctgtgggacaccaccgagcacaagacccacctcgagtaccagaccctggtatcg
gatctggtgctcgaatccgactacttggggtga

DBGET integrated database retrieval system