KEGG   Mycobacterium marinum M: MMAR_2663Help
Entry
MMAR_2663         CDS       T00694                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
mmi  Mycobacterium marinum M
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:mmi00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3246594..3248765)
Genome map
AA seq 723 aa AA seqDB search
MTELAPSLVELARRYGIATEFQDWSGQCIPVSQDTLVAVLAALGVRADTEQRRNAALTEN
LRSYWTRSLPATIVSRAGAQTRFWAHVTHGAPADVWLQLEDGTLRGEVAQIDNFAAPFEL
DGRWIGEASFVLPTDLPIGYHRVYLRSHDYETSTALIITPDWLGLPEKLGNRRAWGLATQ
LYSVRSRRSWGIGDLTDLTDLALWSAYRHGADYVLVNPLHAAAPTAPMEPSPYLPTSRRF
FNPIYLRVEAIPEYADLPKRGRVRQLRENVQRGADQVAVIDRDGIWAAKRAALTLVHRVP
RSAGRELAYTAFCDRQGRALDDFATWCALAERYGDDWHRWPKPLQHPDASGIAAFATKHA
DAIDFHRWLQWQLDEQLAAAQSEATGAGMSLGIMHDLAVGVHPNGADAWALQDVLALGVT
AGAPPDEFNQLGQDWSQPPWRPDRLEQQEYQPFRALIQAVLRHSGGVRIDHIIGLFRLWW
IPEGAAPTEGTYVRYDHEAMIGIVALEAHRAGAVVVGEDLGTVEPWVRDYLLLRGLLGTS
ILWFELDRDGNGDPLPAERWREYCLSSVTTHDLPPTAGYLAGDHVRLRETLGLLTRPVEV
ELEAYRAERAAWLAELRRVGLLDEAAGAGVTAGPEDDPEQVVLALYRYLGRTPSRLLGVA
LTDAVGDRQTQNQPGTTDEYPNWRVPLAGPDGRQVLLEDIFSNARAARLANAVRDQTTPE
SIR
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atgacggagcttgcgccctcgctggtcgaactcgcccgccggtacggcatcgccaccgag
ttccaggactggagcggccagtgcatacccgtctctcaggacactttggtggccgtgctg
gctgccctcggcgttcgggcggacaccgaacagcggcgcaacgccgccctgaccgagaac
ctgcggtcgtattggacgcgctcgttgccggcgaccatcgtctcgcgtgctggcgcgcaa
acgcgtttttgggcgcatgtcactcacggcgctccggccgacgtctggctgcagctcgag
gatggcacgctgcgtggcgaggtggcgcagatcgacaacttcgctgcgccgttcgagctg
gacggtcgctggatcggcgaagccagcttcgtgctgcctaccgatctgccgatcggctac
caccgggtgtatctgcgatcccacgactacgagaccagcacggccctcatcatcaccccg
gattggctggggctgccggaaaagctcggaaaccgtcgagcctggggcctggccacgcag
ctctatagcgttcgatcgcggcggtcctggggtatcggagacctgacggacctgactgat
ttggcgctctggtcggcctaccgccatggcgccgactatgtattggtcaacccgctgcat
gcggcggcaccgaccgcgcccatggagccctcgccctacctgccgacatcccggcgattc
ttcaatccgatctaccttcgtgtcgaggcgattccggaatacgccgatctacccaagcga
gggcgggtacgccaactgcgtgagaacgtgcaacggggggcggaccaggtcgccgtcatc
gaccgcgacgggatatgggcggccaagcgcgcagccctcaccctggtccaccgggtaccc
cgctcggcggggcgtgagctggcctataccgcgttctgcgaccggcagggccgagctttg
gatgacttcgccacctggtgcgcgctggccgagcggtacggcgatgactggcaccgttgg
ccgaagccgctgcagcatcccgatgcctctggcatcgcggctttcgcgaccaagcacgcg
gatgccatcgacttccaccggtggttgcagtggcaactcgacgagcagctcgccgcggcg
cagtcggaagcgaccggtgccggcatgtcgctggggatcatgcatgacctcgccgtgggc
gttcaccccaacggggccgacgcgtgggccctacaggacgtgctggccttgggcgtcacc
gcgggcgcacccccggatgagttcaatcagctcgggcaggactggtcgcaaccgccatgg
cggccggaccgactcgagcagcaggagtaccagccgtttcgcgcgctcatccaggctgtg
ctgcggcactcaggcggggtccggatcgaccacatcatcgggctgttccggctctggtgg
attcccgagggagccgccccaaccgagggtacttatgtgcgctatgaccacgaggccatg
atcggcatcgtcgcgctggaagcgcatcgcgccggagctgtggtcgtcggcgaggatctc
ggcaccgtcgaaccttgggtgcgtgactacttactcctgcgcggcttgctgggcacctcg
atcttgtggtttgagctcgaccgggacggaaacggtgacccgcttccggccgaacgctgg
cgggagtactgcttgtcgtcggtaaccacgcacgatcttccgccgacagccgggtacctg
gccggcgaccacgtgcgattgcgcgaaacgctggggctgttgacccgaccggtggaggtc
gaattggaggcataccgggcggagcgagccgcctggctagcggaattgcgccgcgttggc
ctactcgacgaagcggccggagccggcgtaacagccgggccggaagacgaccccgaacag
gtcgtgctcgcgttgtatcgctacctggggcggacaccgtcacggctgctgggggtggca
ctgaccgacgcggttggcgatcggcagacccaaaatcagccgggaaccacagacgagtat
ccgaactggcgagttccgctggccggccccgacggccgccaggtgctgctggaagacatc
ttcagcaatgccagggccgccaggctggccaacgccgttcgcgatcagacgacgccagaa
agtatccggtag

DBGET integrated database retrieval system