KEGG   Mycobacterium marinum: MMAR_2713Help
Entry
MMAR_2713         CDS       T00694                                 

Gene name
glcB
Definition
malate synthase G
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
mmi  Mycobacterium marinum
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:mmi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MMAR_2713 (glcB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MMAR_2713 (glcB)
   00630 Glyoxylate and dicarboxylate metabolism
    MMAR_2713 (glcB)
Enzymes [BR:mmi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     MMAR_2713 (glcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3311551..3313746)
Genome map
AA seq 731 aa AA seqDB search
MTDRVSAGNLRVARVLYDFVNNEALPGTDIDQDSFWAGVDKVVTDLTPQNQDLLKTRDDL
QAQIDKWHRHRVIEPLDPQAYREFLTEIGYLLPAPEDFTITTSGVDDEITTTAGPQLVVP
ILNARFALNAANARWGSLYDALYGTDVISESDGAEKGRGYNKVRGDKVIAYARQFLDDSV
PLAGASYTDATGFKVEDGQLVVSLADTSAALADPGQFAGYTGTAENPKSILLANHGLHIE
ILIDPESQIGATDGAGVKDVILESAITTIMDFEDSVAAVDADDKVLGYRNWLGLNRGDLS
EDVTKDDKTFTRVLNTDRTYTAPHGGELTLPGRSLLFVRNVGHLMTNDAIVSDAEGAEGA
PVFEGIMDALFTGLIAIHGLRSTDANGLLTNSRTGSIYIVKPKMHGPAEVAFTCELFSRV
EDVLGLPQGTMKVGIMDEERRTTLNLKACIKAAADRVVFINTGFLDRTGDEIHTSMEAGP
MIRKGAMKNTAWIKAYEDANVDTGLAAGFSGKAQIGKGMWAMTELMADMVEQKIAQPKAG
ATTAWVPSPTAATLHAMHYHKVDVFAVQKELQGKTRTSVDELLTIPLAKELAWAPEEIRE
EVDNNCQSILGYVVRWIDQGVGCSKVPDIHNVALMEDRATLRISSQLLANWLRHGVITSE
DARASLERMAPLVDKQNAGDPEYHAMAPNFDDSIAFLAAQDLILSGAQQPNGYTEPILHR
RRRELKARAGA
NT seq 2196 nt NT seq  +upstreamnt  +downstreamnt
atgacggatcgcgtgtcggcggggaatttgcgcgtcgctcgggtgctctacgacttcgta
aacaacgaggccctgcccggcaccgacatcgaccaggacagcttctgggcgggcgtggac
aaggtggtcaccgacctcaccccgcagaaccaggatttgctgaagactcgcgatgatctg
caggcccagatcgacaagtggcatcgccaccgggtgatcgagccgttggacccgcaggcc
taccgcgagttcctcaccgagatcgggtacctgctgccggcacccgaggacttcaccatc
accacctccggggttgacgacgagatcaccacgaccgccggcccgcagctggtggtgccg
atcctcaacgcgcggttcgccctcaacgctgccaacgcccgctggggctcgctctacgac
gccttgtacggcaccgacgtcatctccgaaagcgacggcgccgaaaagggccggggctac
aacaaggtccgtggtgacaaggtaatcgcctacgcgcgccagttcctcgacgacagcgtg
ccgctggcgggggcctcctacaccgatgccacaggcttcaaggtggaagacggacagctg
gtggtgtcgctggcggacacgtccgcagcgctggccgatcccggccagttcgccggctac
accggcaccgccgagaaccctaagtcgatcctgctggccaatcacgggctgcacatcgag
atcctgatcgaccccgagtcgcagatcggtgccaccgacggcgccggcgtcaaggacgtg
atcctggagtccgccatcaccacgatcatggacttcgaggactcggtggccgcggtcgac
gctgacgacaaggtgctgggctatcggaactggctcggactgaaccggggcgatctgtcc
gaggacgtcaccaaggacgacaagaccttcacccgggtgctcaacaccgaccgcacctac
accgccccgcacggtggtgagctgaccttgcccggccgcagcctgttgttcgtccgcaac
gtgggccacctgatgaccaacgacgccatcgtttcggacgcggaaggcgccgagggcgcc
ccggtgttcgagggcatcatggatgcgctgttcaccggcctgatcgccatccacggtctg
cgaagcaccgatgccaacgggctgttgaccaacagccgcacgggctccatctacatcgtc
aagcccaagatgcacggtcccgccgaggtggcgttcacctgtgaattgttcagccgcgtc
gaggacgtgctggggttgccgcaggggaccatgaaggtcggcatcatggacgaagagcga
cgtaccacgctcaacttgaaggcatgcatcaaggcggccgccgaccgggtggtgtttatc
aacaccggcttcctggaccgcaccggtgatgagatccacacctcgatggaagccggcccg
atgatccgcaagggcgcgatgaagaacacggcgtggatcaaggcctacgaggacgccaac
gtcgacaccgggctcgccgccggcttctccggtaaggcgcagatcggcaagggcatgtgg
gcgatgaccgaactgatggccgacatggtggagcagaagattgcccagccgaaggccggc
gcgaccaccgcgtgggtgccatcgcccaccgcggccaccctgcacgcgatgcactatcac
aaggtggatgtctttgccgtgcagaaggagctgcagggcaagacccgcaccagcgttgac
gaattgctgaccattccgttggccaaggaactggcctgggcgcccgaggagatccgcgaa
gaggtcgacaacaactgccagtccatcctcggttacgtggtgcgttggatcgaccagggc
gtcggctgttcgaaggttcccgacatccacaacgtggccctcatggaggaccgcgccacc
ctgcggatttccagccagttgctggccaactggctacggcatggcgtgatcaccagcgag
gatgcgcgggctagcctcgagcgcatggcaccgctggtggacaagcagaacgccggagat
cccgaataccacgcgatggcacccaatttcgacgacagcatcgcattcctggcggcccag
gatctgatcttgtcgggggcacagcagcccaacggatacacggagccgatcctgcaccgc
cgtcgtcgtgaattgaaggcacgcgctggtgcctga

DBGET integrated database retrieval system