KEGG   Mycobacterium marinum: MMAR_2782Help
Entry
MMAR_2782         CDS       T00694                                 

Gene name
adhC
Definition
NADP-dependent alcohol dehydrogenase AdhC
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
mmi  Mycobacterium marinum
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mmi00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    MMAR_2782 (adhC)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MMAR_2782 (adhC)
  Lipid metabolism
   00071 Fatty acid degradation
    MMAR_2782 (adhC)
  Amino acid metabolism
   00350 Tyrosine metabolism
    MMAR_2782 (adhC)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    MMAR_2782 (adhC)
   00626 Naphthalene degradation
    MMAR_2782 (adhC)
Enzymes [BR:mmi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     MMAR_2782 (adhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3385997..3387010)
Genome map
AA seq 337 aa AA seqDB search
MATHKAVQIGAAGGLLQLVDVDTAPPGDGEVRISVSACGICGTDRAFVHGAFPGLGWPLT
PGHEIAGRIAEIGNGVEDFAVGDRVAVGWFGGNCNHCDPCRKGMFIHCAKMKVPGWQYPG
GYAESVTVPATALARIPAELSDAEAAPMGCAGVTTYNALRHTRARPGDRVAVLGVGGLGH
LGLQFCRAMGFETVAIARGSAKAEDARQLGAHHYIDSTTGDVAEALRRIGGAAVVLATAG
NSAAMAETVGGLLPRGELVVIGVTADPLPISPVQLINPGLSVTGHPSGTAKDVEETMHFA
VLSGVRAWIEERPLAQAADGYEAMEQGRTRYRTVLAM
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atggcaacccacaaagctgtccaaattggtgcggcgggcgggctcctgcagctggttgac
gtcgatactgctccgccgggtgatggcgaggtgcgtatatcagtttctgcgtgtggtatt
tgcggcaccgaccgggcatttgtgcacggggcctttccaggcctgggctggccgctgacg
cctggacacgagatcgccggaagaatagccgaaatcggaaatggggttgaggatttcgcg
gttggcgaccgcgtcgctgtcggttggttcggcggaaactgtaaccactgcgatccctgc
cgcaagggaatgttcatccactgcgccaagatgaaggttccgggctggcagtatcccggt
ggctatgcggaatcggtgacggtgccggccaccgcgctggctcgcattccggcggagctc
tccgacgccgaggcggctccaatgggttgcgccggcgtcacgacgtacaacgcgttgcgt
catacccgggcacggccgggtgatcgggtggcggtgctcggcgtcgggggtctgggccat
ctggggctacagttctgtcgtgccatgggatttgagactgtggcgatcgctcgcggtagt
gccaaggccgaggatgcacgccagctgggagcccaccattacatcgattccaccacgggt
gacgtagcggaagcattacgacggatcggcggtgccgcggtcgtattggcgaccgctggc
aattcggcagctatggctgaaacggtgggcggacttcttccccgcggcgagttggtcgtc
attggcgtgacggctgatccgctaccgatcagcccggtccagctgatcaaccccggcctc
agcgtcacgggtcacccatccggtaccgctaaagacgtggaggaaaccatgcatttcgcg
gtcttgtccggtgtgcgggcctggatcgaagagcgaccgctcgcgcaggcagccgatgga
tatgaggcgatggagcaaggccggacgcgttatcgcacggtcctggccatgtga

DBGET integrated database retrieval system