KEGG   Mycobacterium marinum: MMAR_2801Help
Entry
MMAR_2801         CDS       T00694                                 

Gene name
aao
Definition
D-amino acid oxidase Aao
Orthology
K00273  
D-amino-acid oxidase [EC:1.4.3.3]
Organism
mmi  Mycobacterium marinum
Pathway
Glycine, serine and threonine metabolism
Penicillin and cephalosporin biosynthesis
Arginine and proline metabolism
D-Arginine and D-ornithine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmi00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MMAR_2801 (aao)
   00330 Arginine and proline metabolism
    MMAR_2801 (aao)
  Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    MMAR_2801 (aao)
  Biosynthesis of other secondary metabolites
   00311 Penicillin and cephalosporin biosynthesis
    MMAR_2801 (aao)
Enzymes [BR:mmi01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.3  D-amino-acid oxidase
     MMAR_2801 (aao)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3402911..3403894)
Genome map
AA seq 327 aa AA seqDB search
MGSGRTAASDAQQVVVIGAGVSGLTSALCLAEAGWPVRVWTDLLPRQTTSAVAGAVWRPR
FVEPVVKTRKWAEQSLHRFRELADDPTSGVQLMPAISVGEIAEVDVTASGEDMIPGLRPV
ADTDVPDGFPTATAATLPMIDMPRYLDYLTTRLAAAGCEIEIHPVRSLTEAAQSAPIVIN
CSGLGARELAGDDTLRPRFGQHVVLANPGLDQLFMQLGDGPEWICYFPHPHRVVCGGISI
LDRWDTTADPQVTDRILRDCRRVEPRLADAPVIETITGLRPDRPSVRVEVEQIGATRCIH
NYGHGGDGVTLSWGCALDVARLAGLDC
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
ttgggcagcggtcgcactgcggcaagtgatgcgcaacaagtcgtcgtcatcggcgccggc
gtcagcgggctgacgtcggccctgtgcctggccgaagcgggttggccggtgcgggtgtgg
accgatctgctgccacggcaaaccacctccgcggtggcgggtgcggtgtggcgaccgcga
tttgtggaacccgtcgtcaagacccgaaagtgggccgagcagtcactgcatcggtttcgc
gagctggccgacgatccgaccagcggtgtacagctgatgcccgctatcagtgttggggag
atagccgaggtggacgtgacggcgtctggggaggacatgattcccggcctgcgtccggtc
gccgacaccgacgttccggatggctttcccacggctactgcagcgaccctgccgatgatc
gatatgccccgctaccttgattacttgacgacgcggcttgccgcggcgggttgtgaaatt
gagatacacccggtgcggtcgctaaccgaagccgctcagagcgcaccgatcgtgatcaat
tgttctggtctgggtgccagagagttggccggcgatgacacccttcggccgcgatttggc
cagcatgttgtgctggccaaccccggcttggaccaactgttcatgcagctaggtgatggc
ccggaatggatctgctacttccctcacccgcaccgggtggtgtgcggcggcatcagcatt
cttgatcgctgggacaccactgcggatccccaggtgaccgaccgtatcctgcgagactgc
cggcgggtcgaacccagattggccgacgcgccggtcatcgaaacaattaccggactgcgg
cccgatcggccgtcggtgcgcgtggaagtcgaacagattggggcgacgcggtgcattcac
aactacggtcacgggggcgatggtgtgactttgtcgtggggttgcgcgcttgatgttgcg
cggctggccggcctcgattgctga

DBGET integrated database retrieval system