KEGG   Mycobacterium marinum: MMAR_2821Help
Entry
MMAR_2821         CDS       T00694                                 

Gene name
aceAb
Definition
isocitrate lyase AceAb
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
mmi  Mycobacterium marinum
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:mmi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MMAR_2821 (aceAb)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    MMAR_2821 (aceAb)
Enzymes [BR:mmi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     MMAR_2821 (aceAb)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3418358..3420646
Genome map
AA seq 762 aa AA seqDB search
MAIAETDTEVRTPFEQEVADTQRYFDSSRFAGIVRLYTARQVVEQRGTIPNDYTVARTAA
GAFYQRLRELYAEKKSVTTFGPYSPGQAVSMKRMGIEAIYLGGWATSAKGSTTEDPGPDL
ASYPLSQVPDDAAVLVRALLTADRNQEYLRLQMTDQQRATTTAYDFRPFIIADADTGHGG
DPHVRNLIRRFVEVGVPGYHIEDQRPGTKKCGHQGGKVLVPSDEQIKRLNAARFQLDVMR
VPGIIVARTDAEAANLIDSRADERDQPFLLGATKLDIPSYKSCFLAMLRRFYELGVKELN
GHLLYALADAEYAAANGWLERSGIMSLISDAVNSWREDGMQTIDDLFDQVESRFVAAWED
DAGLMTYAEAVAEVLAFGQSEGDPVAMSPEEWRTFAARASLYAARQKAKELGVDPGWDCE
LAKTPEGYYQIRGGIPYAIAKSLAAAPFADILWMETKTADLADARQFAEAIHAEFPDQML
AYNLSPSFNWDTTGMTDEEMKRFPEELGKMGFVFNFITYGGHQIDGVASEEFATALRQDG
MLALARLQRKMRLVESPYRTPQTLVGGPRSDAALQASSGRTATTKAMGKGSTQHQHLVQT
EVPKKLLEEWLALWSDHYQLGEKLRVQLRPRRAGSDVLELGIYGNDDEQLANVVFDPIKD
RHGRSILTVRDQNTFAHKLRQKRLMTLIHLWLVHRFKADAVYYVTPTEDNQYQTSKMKSH
GIFSEVNQDVGEIIVAEVNRPRIEELLTADRVALRQLITKGD
NT seq 2289 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgccgaaacggacactgaagtccgcacaccgttcgagcaagaagtcgccgac
acacagcgatacttcgacagttcccgttttgccgggatcgttcgcctctatacggcgcga
caagtcgtagagcagcgcggcacgattccgaacgactacaccgtcgcacgaaccgccgcg
ggcgccttctaccagcgcctacgcgagctctacgccgagaagaagagcgtaaccaccttc
ggcccctactcgccgggccaggccgtgagcatgaagcgcatgggcatcgaggcgatctac
ctaggcggatgggcgacctcggccaagggttccacgaccgaggaccccggacccgacctg
gccagctacccgctgagtcaggtgcccgacgatgcggcggtactggtacgcgccctgctt
accgccgaccgtaatcaggagtacctgcgcctgcagatgaccgaccagcagcgcgccacg
accacggcctacgactttcggcccttcatcatcgccgacgccgacaccggccacggcggt
gatccacacgtgcgcaacctcatccgccgcttcgtcgaggttggagtgcctggctaccac
atcgaggaccagcgcccgggcaccaagaagtgcggccaccaaggcggcaaggttctggtg
ccgtccgacgaacagatcaaacgtctcaacgccgctcgtttccagctcgacgtgatgcga
gtcccgggcatcatcgtcgcgcgcaccgatgccgaagcagccaatctgatcgacagccgc
gccgacgaacgggaccagcctttcctgctgggcgccaccaaactcgatatcccctcctac
aagtcctgcttcctggccatgctccggcgcttctacgaactgggcgtcaaggaactcaac
ggtcacctgctctacgctctcgccgatgccgagtacgccgccgccaacggctggctcgag
cgttccggcatcatgagcctgatctccgacgccgttaactcctggcgcgaagacgggatg
cagaccatcgacgaccttttcgaccaagtcgaatcccggttcgtggccgcgtgggaggac
gacgccggcctgatgacctatgcagaggctgtggccgaggtgctcgcgttcggtcaaagc
gaaggcgatccggtggcgatgagccccgaagaatggcggactttcgccgcgcgcgcatcg
ctttatgcggctcggcaaaaggcaaaggaattgggcgtcgaccccggctgggactgcgag
ttggcaaaaacgccagaaggctattaccaaatccggggcggcataccgtatgcaatcgcc
aagtcgcttgcggcggcaccatttgccgacatcctctggatggagaccaagacggccgac
ctcgccgacgcgcggcagttcgccgaggcgatccatgccgagttcccggaccagatgttg
gcctacaacctctcgccgtcgttcaactgggataccaccggcatgaccgacgaggagatg
aagcgcttccccgaagagctgggcaagatgggcttcgtcttcaacttcatcacctacggt
gggcatcagatcgatggtgttgcctccgaagaattcgcaacggcgttgcgacaggacggc
atgctggcgctggctcggctgcagcgcaagatgcgcctcgtcgagtccccttatcgcaca
ccacagaccctggtcggcggcccgcgcagcgatgctgcgctgcaagcctcgtccggacgc
acggcgactaccaaggcgatgggcaagggctccacacagcaccaacatctcgtgcagacc
gaggtgcccaagaagctgctggaggagtggctggcgctgtggagcgatcactaccagctg
ggcgaaaagctgcgcgttcagctgcggcctcgccgcgccggctccgacgtgctggaactg
ggaatctacggcaacgacgacgaacagttggccaacgtcgtgttcgatcccatcaaggac
cgccacggccgcagcattctcaccgtgcgtgaccagaacacgttcgctcacaagcttcgc
cagaagcggctgatgaccttgatccacctctggctggtccaccggttcaaggctgacgcg
gtctactacgtcacgcctaccgaagacaaccagtatcagacctcaaagatgaagtcgcat
gggatcttcagcgaggtcaaccaggacgtgggcgagatcattgtcgcggaggtcaaccgc
ccgcgcatcgaggagttgctgacggcggaccgggtggcgctgcgacagttgatcaccaag
ggcgactag

DBGET integrated database retrieval system