KEGG   Mycobacterium marinum: MMAR_2945Help
Entry
MMAR_2945         CDS       T00694                                 

Definition
1-aminocyclopropane-1-carboxylate deaminase
Orthology
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
mmi  Mycobacterium marinum
Pathway
Cysteine and methionine metabolism
Brite
KEGG Orthology (KO) [BR:mmi00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    MMAR_2945
Enzymes [BR:mmi01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.15  D-cysteine desulfhydrase
     MMAR_2945
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3553803..3554792
Genome map
AA seq 329 aa AA seqDB search
MNAYLHQRFPELRTTLERVTLGDGPTPVRPLSHLISACPSIWIKDDGAYGNGGWGGNKVR
KLEWLLPEVRRQRRSTILTFGGLGTNWGLAATLYAAELGIHTALALIDQPVDEHVEAQLD
RLRASGADIYLTRSKARTVAAAPYLYLRHRRPYLLPAGGSSPLGVIGYVEAAFELAAQLR
DGALPTPSSIVTAVGSGGTVAGLHLGLTLAGLTDIQVIGVVVNDKLRLDHRSITSLARRA
ARLLQDRGAKLPSIDLPAERLTLLRDWLGPGYGHPTSQGTLALKLARESEHLDLEPVYTA
KAMAALLDLTTSGRLPVGPTLYLHTNGPR
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgcctacctgcatcagcgattccccgagctgcgcaccaccctcgagcgcgtcacc
ctcggcgacggtcccacacccgtgcgccccctgtcccatctgatcagcgcttgcccgtcg
atctggatcaaagacgacggcgcctacggcaacgggggctggggcggcaacaaagtccgc
aaactggaatggctgctgcccgaagtaaggcgccaacggcgaagcacgatcctgaccttc
ggtgggctgggcaccaactggggactcgcggccacgctctacgccgccgagctgggcatt
cacaccgctctggcactcatcgaccagccggtagacgagcatgtcgaagcccagctcgac
cgccttcgggcatccggtgccgacatctatctgacgcgctccaaggcccgaacggtggcc
gccgccccgtacctatacctgcgccaccgacgtccctacctgctaccggccggcgggtcc
tcacccctgggagtcatcggctatgtcgaggcagcattcgaactcgccgcgcagcttaga
gacggtgcgctgccgacgccatcgtcgatcgtcaccgcggtcgggtctgggggtacggtg
gccggcctgcacctgggcctcacgctcgccggcctgaccgatattcaggtgatcggcgtc
gttgtcaacgacaagctccgactcgaccatcgatcgatcacatcgctggctcgacgggcc
gcacgtctgctgcaagatcgcggcgccaagctaccgtccatcgacctgcctgccgaacgg
ctgaccctgctgcgcgactggctggggcccggttacggccacccgaccagccaggggact
ctggcactgaaactcgcgcgcgaatccgagcatctcgatctcgaacccgtctacacggcc
aaagcgatggccgccctgctcgacctgaccaccagcggccggctgccagtgggaccgact
ctctacctgcacaccaacgggccgcggtag

DBGET integrated database retrieval system