KEGG   Mycobacterium marinum: MMAR_2992Help
Entry
MMAR_2992         CDS       T00694                                 

Gene name
folE_1
Definition
GTP cyclohydrolase I FolE
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
mmi  Mycobacterium marinum
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    MMAR_2992 (folE_1)
Enzymes [BR:mmi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     MMAR_2992 (folE_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3617137..3617865
Genome map
AA seq 242 aa AA seqDB search
MPSAPHQGRYQMPPLRPSAWQMTNDGVAYGAASYHPNSGYPHSGRRPMNSPAWYDNNPDL
AVECAVQQLLDALGVDDGEHTAGTPARVARAWREMLWGYHEVPEDQLATDFPAPDDPGLI
VMHGISFSSTCAHHLLPFTGTATIAYRPHPGQRIVGLSKLARLVHGYAARLQVQERIGQQ
AVDGIMRRLNPSGAMCIITARHDCMRLRGVRDPAAEATTEARKGIWSDHEMALIHRLHGG
AR
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgccatcggcaccccaccaggggcgctaccagatgccgccgttgcggcccagcgcctgg
cagatgacaaatgacggcgtcgcgtacggggcggcgtcctaccacccgaattcgggctac
ccacattcgggccggcgcccgatgaattcaccggcgtggtacgacaacaacccagacctg
gccgtcgaatgcgccgtccagcagttactcgacgcactgggcgtggacgacggagagcac
accgccgggacgcccgcgcgcgtcgcacgagcgtggcgagagatgttgtggggatatcac
gaggtaccggaggaccagctcgctaccgactttcccgctcccgatgacccgggactgatc
gtcatgcacggcatttcgttctcctccacctgcgcacaccatctcttgccgttcaccggc
accgccacgatcgcctaccgcccgcatccgggccagcgcatcgtcggcttgtccaaactg
gcccggctggtgcacggttacgccgcacggctgcaggtacaagagcgcatcggacagcaa
gcggtggacggaataatgcgcaggctcaacccctccggagccatgtgcatcatcaccgcc
agacacgattgcatgcgactgcgcggggtacgcgatccggccgccgaggcgactaccgaa
gcgcgaaaaggtatttggtcagatcatgaaatggcgttgattcatcgcctgcacggcgga
gcccgctga

DBGET integrated database retrieval system