KEGG   Mycobacterium marinum M: MMAR_3016Help
Entry
MMAR_3016         CDS       T00694                                 

Gene name
pncA
Definition
pyrazinamidase/nicotinamidase, PncA
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
mmi  Mycobacterium marinum M
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:mmi00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3638835..3639395)
Genome map
AA seq 186 aa AA seqDB search
MRALIIVDLQNDFCAGGALPVHNADLVARAINDYLAGSPGYDRVVATQDFHIDPGAHFSD
SPDYSSSWPPHCRAGSTGAQFCPDLDVAPIEAVFRKGAYCAAYSGFEGVDRHGTTLEDWL
RQRSIDAVDVVGVATDHCVRQTAEGAVRAGFATRVLLDLTAGISAETTEVALARMRTAGV
ALVGSR
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
gtgcgagcgttgatcatcgtcgatctgcagaacgatttctgcgccggcggcgcgctgcca
gtgcacaacgctgacctcgtggcacgcgcgatcaacgactatctggctggtagccccgga
tatgaccgggtggtggccacccaggactttcacatcgatcccggtgctcacttctcggat
tccccggattactcatcgtcgtggccgccgcactgtcgtgccggcagtaccggcgcccag
ttttgtccggatctggacgtcgccccgattgaggcggtgttccgaaagggcgcctactgc
gctgcctacagcggattcgagggcgtggatcgccacggcacgacgctggaggactggctg
cgacagcgaagtatcgatgcggtcgacgtggttggcgttgccaccgaccactgcgtgcgg
cagaccgccgaaggcgcggttcgggccggcttcgctacccgggtgctgctggacctgacc
gcgggcatttcggccgagacaaccgaggtggcgctggccaggatgcgtaccgccggggtc
gcgttggtcgggagccggtaa

DBGET integrated database retrieval system