KEGG   Mycobacterium marinum: MMAR_3163Help
Entry
MMAR_3163         CDS       T00694                                 

Definition
Zn-dependent alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
mmi  Mycobacterium marinum
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mmi00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    MMAR_3163
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MMAR_3163
  Lipid metabolism
   00071 Fatty acid degradation
    MMAR_3163
  Amino acid metabolism
   00350 Tyrosine metabolism
    MMAR_3163
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    MMAR_3163
   00626 Naphthalene degradation
    MMAR_3163
Enzymes [BR:mmi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     MMAR_3163
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3846495..3847667
Genome map
AA seq 390 aa AA seqDB search
MIAEAMVLTGPRNLERRQMTIPDVGDRGAILRVEACGLCGTDHEQFTGHLPAGFSFVPGH
EIVGIVEHVGNAASERWCVRAGQRVAVEVFRSCRDCPECRRGEYRRCAVNGIATMFGFVD
VEIGAGLWGGYATHVELPWDAMLLPIAEDMDPVLATLFNPLGAGIQWGKTLPDTKAGGIV
AILGPGIRGICAAVAAKEAGAAFVAMTGIGPRDDQRLAIARSFGVDLPIDVSQDDAVTAL
QRETGGQLADVVIDVTAKAPSAFADAVALARPGGRVVVAGTRGGGGAPGFEPDTLVYKEL
HIAGALGVEYPAYRAALEILATRRWPFDRITRESTGFAGLAPLLSSLADENAKSSAALHN
VFVPTPSQHAELQQRKVTRDENGTRTDARP
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgatcgccgaggccatggtgttgaccggaccgcggaatctggagcggcgccagatgacc
atccccgacgtcggtgaccgcggtgcgatcctgcgagttgaagcatgtggtctatgcggt
acagatcacgaacaattcaccggacacctgcctgccggcttctcattcgttccaggtcac
gaaatcgtcggcatcgtcgaacatgtcggcaatgcggccagcgaacgctggtgcgtccgg
gccggccagcgcgtggccgtcgaggtgttccggtcctgccgagactgcccggagtgtcgc
cgcggcgaataccggcgatgtgcggtgaacggcatcgccaccatgttcgggttcgtcgac
gtggagatcggcgccgggttatggggcggatacgccacccatgtggagcttccgtgggac
gcgatgctactcccgattgccgaagacatggaccccgttctcgccacgttgttcaaccct
ctcggggccggtatccaatgggggaaaactcttcccgacaccaaggcggggggtatcgta
gcgatactgggaccgggcatccgcgggatctgcgcggcggtggcggcgaaagaggcggga
gccgctttcgtcgcgatgaccggcatcggtccacgcgacgatcagcgactggccatagcc
agatcattcggtgtcgacctgcccatcgacgtatcgcaggacgatgcagtgacagcgctc
cagcgtgagacaggcggacagcttgccgacgtggtcatcgatgtcaccgccaaagcaccc
tccgcgttcgccgacgccgtcgcccttgccaggcctggcggcagggtcgtggttgctggc
acccgcggcggaggcggcgcgcccggctttgaaccagacacgctggtgtataaggaatta
cacatcgccggtgcactcggcgtggagtatcccgcctaccgggcagccctcgagattctg
gccacgcgccgctggccgttcgaccggatcacaagagaatcaaccggattcgctggtctc
gcgccgctgctcagttcgcttgcagatgaaaatgccaaatcgagtgcggccctgcacaac
gtcttcgtgcccacgccctcacagcatgcggagcttcaacagaggaaggtcacacgtgac
gagaacggaacgcgtaccgatgctcgaccttga

DBGET integrated database retrieval system