KEGG   Mycobacterium marinum M: MMAR_3245Help
Entry
MMAR_3245         CDS       T00694                                 

Gene name
asnB
Definition
asparagine synthetase AsnB
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
mmi  Mycobacterium marinum M
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:mmi00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3953372..3955366
Genome map
AA seq 664 aa AA seqDB search
MCGLLAFVAAPAGAAETQGTDTQLAQADQAALAARADSAIAGASHLMRHRGPDEPGTWAD
PDADGSVVFGFNRLSIIDIEHSHQPLRWGPPEAPDRYVLVFNGEIYNYLELREELRAEHG
ATFATDGDGEAIVAGYHHWGADVLRRLRGMFAFALWDTVTRELFCARDPFGIKPLFMATG
PGGTALASEKKCLLDLVDLVGFDTEIDHRALQHYTVLQYVPEPETLHRGVRRLESGCYAR
IRPGCNPVVTRYFVPRFAATPITSATERARYDEITAVLEDSVAKHMRADVTVGSFLSGGI
DSTAIAALAIRHNPRLITFTTGFEREGFSELDVAVASAEAIGARHIAKVVSAEEFVAALP
EIVWYLDEPVADPALVPLFFVAREARKHVKVVLSGEGADELFGGYTIYREPLSLKPFDYL
PRPLRRSMGKVSKPLPEGMRGKSLLHRGSLTLEERYYGNARSFSDAQLQDVLPGFRPQWT
HTDVTAAVYAGSAGWDPVARMQHIDLFTWLRGDILVKADKMTMANSLELRVPFLDPEVFA
VAARLPLQAKITRTTTKYALRRALEPIVPAHVLHRPKLGFPVPIRHWLRAGELLEWAYAM
VTTSQAGHLIDLAAVNRMLDEHRTGASDHSRRLWTLLIFMLWHAIFIERSITPQISEPQY
PVEL
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
gtgtgtggactgctggccttcgttgcggccccggccggcgctgccgagacgcaaggcacc
gatactcaactcgcccaggccgaccaagccgcgctggccgcgcgagccgacagcgcaatc
gcgggcgcgtcgcacctgatgcgccaccgcggccccgacgagcccggcacctgggcagac
ccggatgccgacggttcggtggtcttcggattcaaccggttgtccatcatcgacatcgag
cattcgcaccaaccgctgcgatgggggccacccgaagctcctgaccgctatgtcttggtg
ttcaacggcgagatctacaactacctcgaactacgcgaggaactgcgtgccgagcacggc
gccaccttcgccaccgatggtgatggtgaggccatcgtcgccggttaccaccactggggt
gccgacgtgctgcggcgactccgcggcatgttcgccttcgcgctgtgggacacggtcacc
cgcgaactgttctgtgcccgcgatccgttcggcatcaaaccgctgttcatggcgaccgga
ccgggcggcaccgcgctggctagtgagaagaagtgtctactggacctggtcgacttggtg
ggattcgacactgaaatcgaccaccgggcgctacagcactacacagtcctgcagtacgtc
cccgaacccgagacactgcatcgcggagtccgacggctcgaatcgggctgctacgcgcgc
atccggcccgggtgcaaccccgtagtcacccgctactttgtgccgcggtttgccgccaca
ccgatcaccagcgccaccgagcgggcgcgctacgacgagatcaccgcggtgctagaggac
tcggtggccaaacacatgcgcgccgacgtcactgtcggttcgtttctgtcaggcgggatc
gactccacggccatcgcggcgctggccatccggcacaatccgcggctgatcacctttacc
accggcttcgaacgcgagggtttttccgagctcgacgtggcggtggcctcggccgaagcc
atcggcgcccgccacatcgccaaggtggtcagcgcggaggaatttgtggccgcgttgccc
gaaattgtctggtatctcgacgagccggtcgccgacccggcgctggtaccactgttcttc
gtggcccgcgaggcccgcaagcacgtcaaggtggtgctctccggggagggcgccgacgag
ctgtttggcggatacacgatctaccgcgagccgctctcgctgaaacccttcgactatcta
ccccggccgctgcgacggtcgatgggtaaggtctccaaacccctgcccgagggtatgcgc
ggaaaaagcctgctccatcgcggctcgctgacgctcgaggagcgctactacggcaacgcc
cgaagcttctccgacgcccaactgcaagacgtgctgcccggattccggccgcagtggaca
cacaccgatgtgaccgctgcggtctacgccgggtcagcgggctgggacccggtagccaga
atgcagcacatcgatctgttcacttggctacgcggcgacattctggtgaaggccgacaag
atgacgatggccaattcgctcgaactgcgggtgccattcctggatcccgaggtgttcgcc
gtcgccgcccgattgccgctgcaggccaaaatcacccgcaccaccaccaagtacgcgcta
cggcgcgcattggagccgattgtcccggcacatgtgctgcaccgacccaagctcgggttc
ccagtcccgatccggcactggttgcgcgccggcgaactgttggagtgggcctatgcgatg
gtcaccacgtcgcaggcgggtcacctgatcgacctggcagcggtcaaccggatgctcgac
gagcaccgcaccggcgccagcgatcacagccgccggctgtggaccctgctgatcttcatg
ctgtggcacgcgatcttcatcgagcgcagcatcacaccacagatcagcgagccccagtat
ccggtcgagctctag

DBGET integrated database retrieval system