KEGG   Mycobacterium marinum: MMAR_3245Help
Entry
MMAR_3245         CDS       T00694                                 

Gene name
asnB
Definition
asparagine synthetase AsnB
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
mmi  Mycobacterium marinum
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mmi00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MMAR_3245 (asnB)
Enzymes [BR:mmi01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     MMAR_3245 (asnB)
Peptidases [BR:mmi01002]
 Cysteine Peptidases
  Family C44
   MMAR_3245 (asnB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3953372..3955366
Genome map
AA seq 664 aa AA seqDB search
MCGLLAFVAAPAGAAETQGTDTQLAQADQAALAARADSAIAGASHLMRHRGPDEPGTWAD
PDADGSVVFGFNRLSIIDIEHSHQPLRWGPPEAPDRYVLVFNGEIYNYLELREELRAEHG
ATFATDGDGEAIVAGYHHWGADVLRRLRGMFAFALWDTVTRELFCARDPFGIKPLFMATG
PGGTALASEKKCLLDLVDLVGFDTEIDHRALQHYTVLQYVPEPETLHRGVRRLESGCYAR
IRPGCNPVVTRYFVPRFAATPITSATERARYDEITAVLEDSVAKHMRADVTVGSFLSGGI
DSTAIAALAIRHNPRLITFTTGFEREGFSELDVAVASAEAIGARHIAKVVSAEEFVAALP
EIVWYLDEPVADPALVPLFFVAREARKHVKVVLSGEGADELFGGYTIYREPLSLKPFDYL
PRPLRRSMGKVSKPLPEGMRGKSLLHRGSLTLEERYYGNARSFSDAQLQDVLPGFRPQWT
HTDVTAAVYAGSAGWDPVARMQHIDLFTWLRGDILVKADKMTMANSLELRVPFLDPEVFA
VAARLPLQAKITRTTTKYALRRALEPIVPAHVLHRPKLGFPVPIRHWLRAGELLEWAYAM
VTTSQAGHLIDLAAVNRMLDEHRTGASDHSRRLWTLLIFMLWHAIFIERSITPQISEPQY
PVEL
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
gtgtgtggactgctggccttcgttgcggccccggccggcgctgccgagacgcaaggcacc
gatactcaactcgcccaggccgaccaagccgcgctggccgcgcgagccgacagcgcaatc
gcgggcgcgtcgcacctgatgcgccaccgcggccccgacgagcccggcacctgggcagac
ccggatgccgacggttcggtggtcttcggattcaaccggttgtccatcatcgacatcgag
cattcgcaccaaccgctgcgatgggggccacccgaagctcctgaccgctatgtcttggtg
ttcaacggcgagatctacaactacctcgaactacgcgaggaactgcgtgccgagcacggc
gccaccttcgccaccgatggtgatggtgaggccatcgtcgccggttaccaccactggggt
gccgacgtgctgcggcgactccgcggcatgttcgccttcgcgctgtgggacacggtcacc
cgcgaactgttctgtgcccgcgatccgttcggcatcaaaccgctgttcatggcgaccgga
ccgggcggcaccgcgctggctagtgagaagaagtgtctactggacctggtcgacttggtg
ggattcgacactgaaatcgaccaccgggcgctacagcactacacagtcctgcagtacgtc
cccgaacccgagacactgcatcgcggagtccgacggctcgaatcgggctgctacgcgcgc
atccggcccgggtgcaaccccgtagtcacccgctactttgtgccgcggtttgccgccaca
ccgatcaccagcgccaccgagcgggcgcgctacgacgagatcaccgcggtgctagaggac
tcggtggccaaacacatgcgcgccgacgtcactgtcggttcgtttctgtcaggcgggatc
gactccacggccatcgcggcgctggccatccggcacaatccgcggctgatcacctttacc
accggcttcgaacgcgagggtttttccgagctcgacgtggcggtggcctcggccgaagcc
atcggcgcccgccacatcgccaaggtggtcagcgcggaggaatttgtggccgcgttgccc
gaaattgtctggtatctcgacgagccggtcgccgacccggcgctggtaccactgttcttc
gtggcccgcgaggcccgcaagcacgtcaaggtggtgctctccggggagggcgccgacgag
ctgtttggcggatacacgatctaccgcgagccgctctcgctgaaacccttcgactatcta
ccccggccgctgcgacggtcgatgggtaaggtctccaaacccctgcccgagggtatgcgc
ggaaaaagcctgctccatcgcggctcgctgacgctcgaggagcgctactacggcaacgcc
cgaagcttctccgacgcccaactgcaagacgtgctgcccggattccggccgcagtggaca
cacaccgatgtgaccgctgcggtctacgccgggtcagcgggctgggacccggtagccaga
atgcagcacatcgatctgttcacttggctacgcggcgacattctggtgaaggccgacaag
atgacgatggccaattcgctcgaactgcgggtgccattcctggatcccgaggtgttcgcc
gtcgccgcccgattgccgctgcaggccaaaatcacccgcaccaccaccaagtacgcgcta
cggcgcgcattggagccgattgtcccggcacatgtgctgcaccgacccaagctcgggttc
ccagtcccgatccggcactggttgcgcgccggcgaactgttggagtgggcctatgcgatg
gtcaccacgtcgcaggcgggtcacctgatcgacctggcagcggtcaaccggatgctcgac
gagcaccgcaccggcgccagcgatcacagccgccggctgtggaccctgctgatcttcatg
ctgtggcacgcgatcttcatcgagcgcagcatcacaccacagatcagcgagccccagtat
ccggtcgagctctag

DBGET integrated database retrieval system