KEGG   Mycobacterium marinum: MMAR_3260Help
Entry
MMAR_3260         CDS       T00694                                 

Gene name
sucB
Definition
dihydrolipoamide acetyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
mmi  Mycobacterium marinum
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mmi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MMAR_3260 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MMAR_3260 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    MMAR_3260 (sucB)
Enzymes [BR:mmi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     MMAR_3260 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3971257..3973023
Genome map
AA seq 588 aa AA seqDB search
MAFSVQMPALGESVTEGTVTRWLKQEGDTVEIDEPLVEVSTDKVDTEIPSPAAGVLTKIV
AKEDDTVEVGGELAIIGDAAESGGGDAPSQPEPEAEPAAAAQPEPEAEPEPQPEAKPQSG
GSSAAGGDATPVLMPELGESVAEGTVTRWLKKVGDSVQVDEALVEVSTDKVDTEIPSPVA
GVLLSITAEEDDVVQVGGELARIGSGSAAAAPPESKPAPAPEAAPETKAAPEPKAAPEPK
PAPEPKAAPEPKPAPAATPQPAAAPAPSAGDGTPYVTPLVRKLAEENNIDLDSVTGTGVG
GRIRKQDVLAAAEKKKERPEAKPAAAQASAPASPSKAAAPAAAAALAHLRGTKQKASRIR
QITAIKTRESLQATAQLTQTHEVDMTRIVALRARAKGSFAEREGVNLTFLPFIARAVIDA
LKIHPNINASYNEETKEITYYDAEHLGFAVDTDQGLLSPVIHNAGDLSLAGLARAIADIA
GRARSGNLKPDELSGGTFTITNIGSQGALFDTPILVPPQAAMLGTGAIVKRPRVVVDDTG
NESIGVRSVCYLPLTYDHRLVDGADAGRFLTTIKHRLEEGAFEADLGL
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atggccttctcagtccagatgccggcactcggtgagagcgtcaccgagggaaccgtcacc
cggtggctcaagcaggagggcgacaccgtcgagatcgacgagccactggttgaggtttcc
accgacaaggtcgacaccgaaattccctcgccggccgccggtgtgctgaccaagatcgtc
gccaaggaggacgacacggtcgaggtcggcggtgagctcgccatcatcggcgatgcggcc
gagagtggcggcggcgatgcgccgtcccaaccggagcccgaggccgagcccgccgcggcg
gcacagcccgaaccggaggccgagcccgagccgcaacccgaagccaaaccccaatccgga
ggctcgtcggctgctggtggcgacgcgaccccggtgctgatgcccgaactgggcgagtcg
gtggcggagggcaccgtaactcgctggctgaagaaggtcggggattcggttcaggtcgat
gaagcgctggtggaggtgtctaccgacaaggtggacaccgagatcccgtcaccggtggcc
ggcgtcctactcagcatcaccgccgaggaggacgacgtcgtccaggtcggcggcgagttg
gcacggatcggctccggatctgcggccgccgcaccgcccgagtccaagccggcccccgcc
cccgaggccgcacccgaaaccaaggccgctcctgagcccaaggccgcgcccgagcccaag
ccggctcccgagcccaaggcggctcccgagcccaagcctgcgcccgcggcaacgccgcag
cccgcggccgccccggcaccgagtgcgggcgacggcaccccctacgtgactcccctggtc
cgaaaactggccgaggagaacaacatcgacctcgactcggtgaccggcaccggtgtcggc
ggtcgcatccgcaagcaagacgtgttggccgctgccgagaagaagaaagagcgaccagag
gccaagccagcggctgctcaggcttcggctcccgcctcgccttcgaaggcggcagccccg
gctgcggccgcggcgctggcacacctgcggggcaccaagcagaaggccagccggattcgg
cagatcaccgcgatcaagacccgcgaatccctgcaggcaaccgcgcagctcactcagacc
catgaggtcgacatgaccaggatcgtggcgctgcgggcccgggccaaggggtcctttgcc
gagcgggagggtgtgaacctgaccttcttgccgttcatcgcccgtgccgtgatcgacgcc
ctcaagatccacccgaacatcaacgccagctacaacgaggaaaccaaggagatcacctac
tacgacgccgagcacctcgggttcgccgtcgacaccgaccagggcctgctctcccccgtg
atccacaacgccggcgatctgtcgttggccgggctggcccgggcgatcgccgacatcgcc
ggtcgcgctcgatcgggcaacctcaagcccgacgagttgtccggcggcacctttaccatc
accaacatcggcagccagggcgccttgttcgataccccgattctggtgccgccgcaggcc
gccatgttgggtaccggggcgatcgtgaaacgaccgcgagtggtcgtcgacgacaccggc
aacgaatcgatcggcgtccgctccgtgtgctacctcccgctgacctacgaccaccgcctg
gtcgatggtgctgatgcgggacgtttcctcaccaccatcaagcaccgcctcgaagaggga
gctttcgaggccgacctggggctctga

DBGET integrated database retrieval system