KEGG   Mycobacterium marinum: MMAR_3482Help
Entry
MMAR_3482         CDS       T00694                                 

Gene name
pfkB_1
Definition
phosphofructokinase, PfkB
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
mmi  Mycobacterium marinum
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mmi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MMAR_3482 (pfkB_1)
   01230 Biosynthesis of amino acids
    MMAR_3482 (pfkB_1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MMAR_3482 (pfkB_1)
   00030 Pentose phosphate pathway
    MMAR_3482 (pfkB_1)
   00051 Fructose and mannose metabolism
    MMAR_3482 (pfkB_1)
   00052 Galactose metabolism
    MMAR_3482 (pfkB_1)
  Energy metabolism
   00680 Methane metabolism
    MMAR_3482 (pfkB_1)
Enzymes [BR:mmi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     MMAR_3482 (pfkB_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4288010..4288981)
Genome map
AA seq 323 aa AA seqDB search
MTSPADPAVRGPQIVTLTMNPALDITTCVGVVRPTEKLRCSETRYDPGGGGINVARIAHV
LGGSVFAVFPVGGSHGAHVSKLLSEAGVAFGEIPIAASTRESFTVNESSTGEQYRFVLPG
PVLAPEEQAQCLQELGFAARSAQFVVASGSLPPGVPADFYQRVAEACRGLGARLILDTSG
GGLSHISAGVYLLKASVRELRECVGRPLVTEAEQLAAASELVETGRAEVVVVSLGSDGAL
LATRRARHRFRAVEMRGGSGVGAGDAMVAAITVGLARGWPLVKSVRLGIAAGAAMLLTPG
TQACERADVERLFEHVAEPVEVA
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgacgagtccggccgatccggcggtgcgcggaccacagattgtcacgctgaccatgaac
ccggcgctggacatcaccacctgtgtcggcgtggtgcggccgacggagaaactgcgttgc
agcgaaactcgctatgacccgggtgggggaggcatcaacgtcgcgcggatcgcgcacgtc
ctcggcggctcggtgttcgcggtgtttccggtgggcggatcgcatggcgcccacgtcagc
aaactgctcagcgaagccggtgtggccttcggcgaaatcccgatagcggcatcgacgcgg
gagagcttcaccgtcaacgaatccagcaccggcgagcagtatcgttttgtgcttcccgga
cccgtgctggcacccgaagagcaggcccagtgcctgcaagaattgggatttgccgcgcgc
tcagcgcaattcgtggtggccagcggcagcctgccgccgggcgtgccggccgacttctat
cagcgggtcgccgaggcttgccgtggtctgggcgcacgtctgatcctggacacctccggc
ggcgggctcagccacatcagtgcgggggtgtacctactcaaggccagtgtgcgggagctg
cgcgagtgcgtcggtcggccgctggttaccgaggccgagcaattggccgcggcaagcgaa
ctcgtcgaaacgggtcgcgcagaggtcgtggtggtgtcgttgggctctgatggtgcactg
cttgcgactcgccgggcacggcatcgatttcgagcggttgagatgcgaggcggcagcggg
gttggggccggcgacgccatggttgccgcgatcacggtcggtctggctcgcggatggccg
ctggtcaagtcggttcggttgggcattgcggcgggtgcggcaatgctgctgacgccgggt
acgcaagcctgcgagcgtgcggatgtcgagcggctgttcgagcacgtcgccgaaccggtg
gaggtcgcctag

DBGET integrated database retrieval system