KEGG   Mycobacterium marinum M: MMAR_3842Help
Entry
MMAR_3842         CDS       T00694                                 

Gene name
pdhC
Definition
(GenBank) dihydrolipoamide S-acetyltransferase E2 component PdhC
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mmi  Mycobacterium marinum M
Pathway
mmi00010  Glycolysis / Gluconeogenesis
mmi00020  Citrate cycle (TCA cycle)
mmi00620  Pyruvate metabolism
mmi01100  Metabolic pathways
mmi01110  Biosynthesis of secondary metabolites
mmi01120  Microbial metabolism in diverse environments
mmi01130  Biosynthesis of antibiotics
mmi01200  Carbon metabolism
Module
mmi_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mmi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MMAR_3842 (pdhC)
   00020 Citrate cycle (TCA cycle)
    MMAR_3842 (pdhC)
   00620 Pyruvate metabolism
    MMAR_3842 (pdhC)
Enzymes [BR:mmi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     MMAR_3842 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H
Motif
Other DBs
NCBI-ProteinID: ACC42253
UniProt: B2HNK0
Position
complement(4777970..4779139)
Genome map
AA seq 389 aa AA seqDB search
MSTGDRLKCFQVPDLGEGLEEVTVTSWAVAVGDDVELNQVLCSVETAKAEVEIPSPYAGR
IVELGGAEGDVIKVGAALVRIDTAPELPAPTNGEIAVPTLVGYGADAAIDTSRRPGRPRA
APPVRKLAKELMVDLASLQRGSTVITRADVLAAAKGAGASARVREVRGVQAHMAEKMSLS
HQEIPAAKASVEVDCTELLRLSEQFRAAVPPATPFALALRMLVIALKNNEILNSTWVDSP
GGPQVHLHPGVHLGFGVATERGLLVPVIADAHRMTTRELVCRAAELITGAREGTLAPGQL
RGSTFTVSNYGALGVDDGVPVINHPEAAILGMGSIKPRPVVRGDAVVVRPTMSLTCVFDH
RVADGAQVARFICELRGLIEAPETVLLDL
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccggcgaccggctgaagtgcttccaggtgcccgaccttggtgagggcctcgag
gaagtcaccgtgacgagctgggccgtcgcggttggtgatgatgtcgagctcaatcaggtg
ttgtgttcggtggagaccgccaaggccgaagtcgagatcccgagcccctacgccggtcgc
atcgttgaactcggtggcgccgaaggcgatgtcatcaaagtgggcgcagcacttgtgcgc
atcgacacggcaccggagttgccggccccgaccaacggtgagatcgcggtcccgacgctg
gtgggctacggcgccgacgcggccatcgacaccagcaggcgcccaggccggccgcgcgcg
gccccgccggtgcgcaagctggccaaggaactcatggttgacctcgcttcgctgcagcgg
ggtagcacggtgatcacccgggccgatgtactggccgccgcgaagggcgccggagcgtca
gcgcgggttcgggaagtccgtggtgtgcaggcacacatggcggagaaaatgagcctgtcc
caccaagaaatcccggctgcgaaagctagcgtcgaggttgactgcaccgaactgctcagg
ctcagcgaacagttccgggcggcggtgccgccggcgacgccgttcgcgctggcgctgcga
atgttggttatcgctctgaagaacaacgagatactcaactcgacatgggtcgattcgcca
ggaggaccgcaggttcatctgcacccgggagtgcacttgggtttcggtgtagctaccgag
cgcggactgttggtgccggtgatcgccgatgcccatcgcatgaccacgcgtgaattggtt
tgccgcgcggcagagctgatcaccggtgcgcgcgaaggcacccttgcacccgggcagctg
cgcggttcgacgttcaccgtgtcgaactacggggcgctgggcgtcgatgacggagtgccg
gtgatcaaccatcccgaagccgccatcctgggcatggggtcaatcaagccgcggccggtg
gtccgcggtgacgcggttgttgtgcggccgacgatgtcattgacctgcgtgttcgaccac
cgcgtcgccgatggcgcccaagtcgcccggttcatctgtgaattgcgcggtctgatcgag
gcgccggagaccgtgctgttggacctgtag

DBGET integrated database retrieval system