KEGG   Mycobacterium marinum M: MMAR_4102Help
Entry
MMAR_4102         CDS       T00694                                 

Gene name
thrC
Definition
(GenBank) threonine synthase ThrC
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
mmi  Mycobacterium marinum M
Pathway
mmi00260  Glycine, serine and threonine metabolism
mmi00750  Vitamin B6 metabolism
mmi01100  Metabolic pathways
mmi01110  Biosynthesis of secondary metabolites
mmi01120  Microbial metabolism in diverse environments
mmi01230  Biosynthesis of amino acids
Module
mmi_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mmi00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MMAR_4102 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    MMAR_4102 (thrC)
Enzymes [BR:mmi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     MMAR_4102 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ACC42509
UniProt: B2HQL7
Position
complement(5053998..5055080)
Genome map
AA seq 360 aa AA seqDB search
MSASPTAVHKPWPGLIAAYRDRLPVADDWAPVTLLEGGTPLIAAPRLSKQTGCTIHLKVE
GLNPTGSFKDRGMTMAVTDALARGQQAVLCASTGNTSASAAAYAARAGITCAVLIPQGKI
AMGKLAQAVMHGAKIIQIDGNFDDCLELARKMAADFPTISLVNSVNPVRIEGQKTAAFEI
VDALGVAPDVHALPVGNAGNITAYWKGYTEYHRDGIIEKLPRMLGTQAAGAAPLVLGEPV
NHPETIATAIRIGSPASWTSAVEAQQQSKGRFLAATDEEILAAYHLVARAEGVFVEPASA
ASIAGLLKAIDDGWVARGSTVVCTVTGNGLKDPDTALKDMPKVSPVPVDPVAVVEKLGLA
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgcctcgccgaccgcggtccacaagccctggcccggtttgatcgcggcgtaccgg
gaccgcctcccggtggccgatgactgggctcctgtcaccctgctcgagggcggcactccg
ctgatcgcggctcccaggctctccaagcagaccgggtgcacgatccacctcaaggtcgag
ggcctcaaccccaccggatccttcaaggaccggggcatgaccatggcggtgaccgacgcg
ctggcgcgtgggcaacaggccgtgttgtgcgcatcgaccgggaacacgtcggcgtcggcg
gcggcctacgccgcccgtgctggaatcacctgtgcggtgctgatcccgcagggcaagatt
gcgatgggcaagctggctcaggcggtcatgcacggggccaagatcatccagattgacggc
aacttcgacgactgtctggaactggcgcgcaagatggctgccgacttcccgaccatctca
ttggtcaactccgtgaacccggtgcgtatcgagggccagaagaccgcggcgttcgagatc
gtcgacgcgcttggcgtcgcaccggatgtgcacgcacttccagtcggtaacgcgggcaac
atcaccgcgtactggaagggatacaccgagtatcaccgagacggcattatcgagaagttg
cctcgcatgctgggcacccaagccgcgggtgcggcgccgttggttctcggcgaaccggtg
aaccacccggagaccatcgccaccgcgattcgcattggctcgccggcgtcgtggacgtcg
gccgtggaggcgcagcagcagtccaaggggcgcttcctggcggcgactgatgaggaaatc
cttgccgcctatcacctggtcgcgcgcgccgagggggtgttcgtcgagcccgcctcggcg
gccagcatcgccggtctgctcaaggccatcgacgacgggtgggtggcccgcgggtcaacc
gtggtgtgcacggtcaccggcaacggcctgaaggaccccgacaccgcgctcaaagacatg
ccaaaggtgtctccggtacccgttgacccagtcgcggtggttgagaagctggggttggcg
tag

DBGET integrated database retrieval system