KEGG   Mycobacterium marinum: MMAR_4110Help
Entry
MMAR_4110         CDS       T00694                                 

Definition
bifunctional acetaldehyde-CoA/alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
mmi  Mycobacterium marinum
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mmi00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    MMAR_4110
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MMAR_4110
   00620 Pyruvate metabolism
    MMAR_4110
   00650 Butanoate metabolism
    MMAR_4110
  Lipid metabolism
   00071 Fatty acid degradation
    MMAR_4110
  Amino acid metabolism
   00350 Tyrosine metabolism
    MMAR_4110
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    MMAR_4110
   00626 Naphthalene degradation
    MMAR_4110
Enzymes [BR:mmi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     MMAR_4110
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     MMAR_4110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5065092..5067761
Genome map
AA seq 889 aa AA seqDB search
MTTTPTESASPVEAPAIDNLRTAEIDAIVDTAAEAARAFRKLDQQQVDAIVEAMVRAGVR
AAGELAGVAIEETGFGVFEDKVVKNYVATEFLHDYLRGKKSVGVIDEDVEHNIVYVAEPI
GVVLGITPVTNPTSTVLFKAIVAAKTRNAILFRPSPYAVRCCEQSIEILRTAAEAAGMPP
GALQVIPDAAHEVTHYLFKHPKVDFIWVTGGPKIVALANSAGKPGLSVGPGNAPIYIHKT
ADLKGAVVDILISKTFDSSVICPAEQTCIIDDEIYDEMIAEFERMGAQLLTADQAKAVAE
FAFGCGDKVSLDAVGQKAPELAARAGFSVPPTVKVLLAQLPSDLGELAAHPLVQEKLMPV
LGVVRARSVQHGIDAAVLVTEHGGLGHTSAIYANDDDVIEAYGLAVRTGRILVNAPTAVG
ALGGVYNNLTPTFSLGCGTWGGSSTTENVNYRQLLNIKTVSRRRTPPQWFRVPSNTYFNE
GALDNLRELDCETVVVVTDALTEERGVVEALRGKLRAQHVQVFSEVTPEPDETTIRRGVA
LMQRVQPDLLIAIGGGSVLDAGKAMRLFYEHPEKSLDALTMPFLDPRKRVADYPTDRHRI
QLVAVPTTSGTGSEVSPAAVLTVGGKKETLVDYSLVPDLAIVDPVLTSSMPQKLTADTGI
DALTHALEAIVSIFASPYTDALCAQAVRLIFDALPRAYDDPDDLSARTSMSNAATLAGLA
FSNAFVGTNHALAHAVGAKFSVPHGRANGIFLPHVLRYNASLPTKFMPAPGYSAYIAPDK
YAQLGQLVFGGHLPDDSRQRLFAGVDDLLDRLDMPRSLREFGVDEQEFLAALPTLAMTAF
EDLSNRTNPRMPLVSEITDLLRLGYYGDTGVGEPALAPIKPGDVDGRSV
NT seq 2670 nt NT seq  +upstreamnt  +downstreamnt
atgacaacgacaccaaccgagtccgcctcccccgtcgaagcacccgcgatcgacaaccta
cgcaccgccgaaatcgacgccattgttgataccgccgctgaggcggcccgcgccttccgc
aagcttgaccagcagcaggtcgacgcgatcgtcgaggcgatggtgcgggccggggtgcgc
gcggccggcgaactggccggtgtggcgatcgaggagacgggcttcggcgtcttcgaggac
aaggtcgtcaagaactatgtggccaccgaattcctgcacgactatctgcgcggcaagaaa
tcggtgggcgtcatcgacgaggacgtcgagcacaacatcgtctatgtggccgaaccgatc
ggggtggtgctcggcattaccccggtgaccaacccgacctcgacggtgttgttcaaggcg
atcgtggccgcaaagacccgcaacgccattcttttccgaccgtcaccgtatgcggtgcgc
tgctgcgaacaaagcatcgagatcctgcgcaccgcggccgaagcggccgggatgcctccc
ggggcgctgcaggtcatccccgatgccgctcacgaggtgacgcactacttgttcaaacac
ccgaaggtcgacttcatctgggtgaccggcgggccaaagatcgtcgcgttggcgaactcg
gcaggaaagccggggctcagtgtcggtcctgggaatgcgccgatctacattcacaagacc
gcagacctcaagggcgcggtggtcgacatactcatctcgaaaacgtttgactcatcggtc
atctgcccggccgagcagacctgcatcatcgacgacgagatctacgacgagatgatcgcc
gagttcgagcggatgggggcccagttgctcaccgccgaccaggcgaaggcggtggccgag
ttcgcgtttggttgtggcgacaaggtctccctcgatgcggtcgggcagaaggcgccagaa
ctggccgcccgggccggattcagcgtgcctcccacggtgaaagtactgctggcgcagttg
ccgtcggacttgggcgaactcgccgcccacccactggtgcaggagaagctgatgccggtg
ctcggggtggtgcgcgcgcgcagtgtgcagcacggcatcgacgccgccgtcttggtcacc
gagcacggcgggttgggccatacctcggcgatctacgccaacgacgacgacgtcatcgag
gcatatgggttggcggttcgcaccggccgcatcctggtcaacgcgccaaccgcggtcgga
gcgctcggcggggtctacaacaatctgacacccacgttctcgctgggctgtggcacctgg
ggcggatcaagcaccaccgagaacgtcaactatcgccagttgctcaacatcaagacggtt
tcgcggcggcgcacgccgccgcaatggttccgcgtgccgtccaacacctacttcaacgaa
ggggcactggacaatctgcgcgagctcgactgcgagaccgtcgtggtggtaaccgacgca
ctgaccgaggagcgcggcgtggtcgaggcgctgcgtggcaagttgcgcgcccagcacgtg
caggtgttcagcgaagtgacacccgagcccgacgagacgaccatccgccgcggtgtcgcg
ctcatgcagcgggtgcagcccgatctgctgatcgccatcggcggcggttcggtgctcgac
gccggcaaggcgatgcggctgttctacgagcacccggagaaaagcctcgacgctttgacg
atgcccttcctcgacccgcgcaagcgggtggctgactatccgaccgaccgtcatcgcatc
caactcgttgctgtcccaacgacatcgggcactgggtcggaagtttcgccggcggcggtg
ttgaccgttggcgggaagaaggagacgctcgtcgactacagcttggtccccgacctggcg
atcgtggaccccgtgttgacctcgtcaatgccgcagaagctgaccgcggacaccggcatc
gacgcgctgacccacgcgctggaggcgatcgtgtcgatcttcgcctcgccctacacggat
gcgttgtgcgcccaggcggtacggctgatcttcgatgccctgcccagggcgtacgacgat
cccgacgatctgtccgcccgaacgagcatgtccaatgcggcgacgcttgccggcctggcc
ttctcgaatgccttcgtcgggaccaatcatgccctcgcccacgccgttggtgcgaaattc
tcggtcccccatggccgggcgaacggcatcttcctgccgcacgtgctgcgctacaacgca
agtctgcctaccaagttcatgcccgcgcctggatattcggcgtacatcgcaccggataaa
tacgcgcaactcggccagctggtgtttggtggccatcttcccgacgacagccgccagcga
ttgttcgcaggggtcgacgatctgctggaccgactggacatgccgagatcgctgcgggaa
ttcggggttgacgagcaggaattcctggccgcgctgccgacgctggcgatgaccgcgttc
gaggacctcagcaaccgcaccaacccgcggatgccgctggtcagcgagatcaccgatttg
cttcggctgggctactacggtgacaccggcgttggggagccggccctggcgccgatcaag
cccggggatgttgatggacggtccgtttag

DBGET integrated database retrieval system