KEGG   Mycobacterium marinum M: MMAR_4477Help
Entry
MMAR_4477         CDS       T00694                                 

Gene name
ispE
Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase IspE
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
mmi  Mycobacterium marinum M
Pathway
mmi00900  Terpenoid backbone biosynthesis
mmi01100  Metabolic pathways
mmi01110  Biosynthesis of secondary metabolites
mmi01130  Biosynthesis of antibiotics
Module
mmi_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:mmi00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MMAR_4477 (ispE)
Enzymes [BR:mmi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     MMAR_4477 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: ACC42883
UniProt: B2HDJ9
Position
complement(5499211..5500134)
Genome map
AA seq 307 aa AA seqDB search
MPTGSATVRVPGKVNLYLAVGDRRDDGYHELTTVFHAVSLVDEVTVRNADLLSLEVVGEG
ADRLPTDKRNLAWQAAELMAEHVGRAPDVSIFIDKSIPVAGGMAGGSADAAAVLVAMNSL
WELNLPRRDLRMLAARLGSDVPFALHGGTALGTGRGEELATVLSRNTFHWVLAFARSGLS
TPAVFTELDRLRDVGSPPRLAEPGPVLAALAAGDPEQLAPLLGNEMQAAAVSLDPALRRA
LRAGVEAGALAGIVSGSGPTCAFLCRTAESALDVSAQLSGAGVCRTVRIATGPVPGARVV
PTPGIAE
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
gtgcctaccgggtcggcgaccgtaagggtccccggcaaggtcaacctgtacctggcggtc
ggcgatcgccgcgatgacggctatcacgagctgaccacggtgtttcacgcggtctccctg
gtcgacgaggtgacggtgcgcaacgccgacctgctgtcgctggaggtcgtcggcgagggc
gccgacagactgcccaccgacaaacgcaaccttgcctggcaggcggccgagctgatggcc
gaacacgtcggccgcgcaccggacgtgtcgatcttcatcgacaagtcgattccggtggcc
ggcggcatggccgggggcagcgccgacgcggccgcggtactggtggcgatgaattcgctg
tgggagctcaacttgccccggcgcgacctgcgcatgctggccgcgcggctgggcagtgat
gtgccctttgcgctgcacggcggtaccgcgctgggcacgggccgcggcgaggaactggcg
acggtcttgtcccggaataccttccactgggtgctggcgttcgcacgcagcggcctgtcc
accccggcggtgttcaccgagctcgaccggctcagggacgtggggagtccacctcggctc
gccgagcccgggccggtgctggcggctctggcggccggcgatcccgagcagctggcgccc
ctgctgggtaacgagatgcaggccgccgcggtgagtctggacccggcgctgcgccgggcg
ctgcgtgccggggtggaggccggcgccctcgccggcatcgtctcgggctccggtccgacg
tgtgccttcctgtgccgcacggccgagtccgcgctggatgtcagcgcgcagctgtcggga
gcgggcgtctgtcgtaccgttcgaatcgccaccggaccggtgccgggagcccgggtggtg
ccgacgccgggaatcgcggagtag

DBGET integrated database retrieval system