KEGG   Mycobacterium marinum M: MMAR_4521Help
Entry
MMAR_4521         CDS       T00694                                 

Gene name
galU
Definition
UTP--glucose-1-phosphate uridylyltransferase GalU
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mmi  Mycobacterium marinum M
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:mmi00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:mmi00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:mmi00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:mmi00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5550742..5551659)
Genome map
AA seq 305 aa AA seqDB search
MSQEVAIPFTAIVPAAGLGTRFLPATKTVPKELLPVVDTPGIELVAAEAAAAGAERLVIV
TSEGKDGVVAHFVEDLVLEGTLEARGKTAMLAKVRRAPALIKVESVVQAEPLGLGHAISC
VEPTLSDDEDAVSVLLPDDLVLPTGVLETMSKVRARLGGTVLCAIEVSPDEISAYGVFDV
EPVPGGEWAANPDVLKVKGMVEKPKTQDAPSMFAAAGRYVLDRAIFDALRRIERGAGGEV
QLTDAIALLIAEGHPVHVVVHRGSRHDLGNPGGYLKAAVDFALDRDDYGPDLRRWLVARL
GLTEQ
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgtcacaagaagttgcgatcccctttacggcgatcgttcccgctgccggcctgggcacg
cggttcctacctgcgaccaagacggtgcccaaggagctgctgccggtcgtcgacacgccc
ggtatcgagctggtggccgccgaggcggccgccgccggtgccgagcggctggtgatcgtc
acttcggagggcaaagacggggttgtcgcgcactttgtcgaggacttggtgctcgagggc
acgttggaggcccgcggcaagacggccatgctggccaaggttcgccgggccccggcgctg
atcaaggtcgagtccgtggtgcaggccgagccgctcggactggggcatgccatcagctgt
gtcgagccgacgctgtccgatgatgaggacgccgtatcggtgctcttgcccgacgacctg
gtgctgccgaccggcgtgctggagacgatgtcgaaggtgcgggcccggctgggcggcacg
gtgttgtgtgccatcgaggtatcccccgacgagatcagcgcctacggcgtgttcgatgtc
gagccggtgccgggcggggaatgggcggcaaatcccgatgttctcaaggtcaaggggatg
gtcgaaaagcccaagacccaagacgcgccgtcgatgttcgcggccgcggggcgctatgtg
ctcgaccgcgccatcttcgatgcgctgcgccggatcgagcgcggcgccgggggtgaagtt
cagctcaccgacgcgatcgcgctgctgatcgccgaggggcatccggtccatgtcgtggtg
caccgcggatcccgacacgacttgggaaatcccggcggctacctcaaggctgcggttgac
tttgcattggatcgtgacgactacggcccggatttgcggcgatggttggtggcgcgattg
ggcctgaccgagcagtag

DBGET integrated database retrieval system