KEGG   Mycobacterium marinum: MMAR_4521Help
Entry
MMAR_4521         CDS       T00694                                 

Gene name
galU
Definition
UTP--glucose-1-phosphate uridylyltransferase GalU
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mmi  Mycobacterium marinum
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mmi00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    MMAR_4521 (galU)
   00052 Galactose metabolism
    MMAR_4521 (galU)
   00500 Starch and sucrose metabolism
    MMAR_4521 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    MMAR_4521 (galU)
Enzymes [BR:mmi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     MMAR_4521 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5550742..5551659)
Genome map
AA seq 305 aa AA seqDB search
MSQEVAIPFTAIVPAAGLGTRFLPATKTVPKELLPVVDTPGIELVAAEAAAAGAERLVIV
TSEGKDGVVAHFVEDLVLEGTLEARGKTAMLAKVRRAPALIKVESVVQAEPLGLGHAISC
VEPTLSDDEDAVSVLLPDDLVLPTGVLETMSKVRARLGGTVLCAIEVSPDEISAYGVFDV
EPVPGGEWAANPDVLKVKGMVEKPKTQDAPSMFAAAGRYVLDRAIFDALRRIERGAGGEV
QLTDAIALLIAEGHPVHVVVHRGSRHDLGNPGGYLKAAVDFALDRDDYGPDLRRWLVARL
GLTEQ
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgtcacaagaagttgcgatcccctttacggcgatcgttcccgctgccggcctgggcacg
cggttcctacctgcgaccaagacggtgcccaaggagctgctgccggtcgtcgacacgccc
ggtatcgagctggtggccgccgaggcggccgccgccggtgccgagcggctggtgatcgtc
acttcggagggcaaagacggggttgtcgcgcactttgtcgaggacttggtgctcgagggc
acgttggaggcccgcggcaagacggccatgctggccaaggttcgccgggccccggcgctg
atcaaggtcgagtccgtggtgcaggccgagccgctcggactggggcatgccatcagctgt
gtcgagccgacgctgtccgatgatgaggacgccgtatcggtgctcttgcccgacgacctg
gtgctgccgaccggcgtgctggagacgatgtcgaaggtgcgggcccggctgggcggcacg
gtgttgtgtgccatcgaggtatcccccgacgagatcagcgcctacggcgtgttcgatgtc
gagccggtgccgggcggggaatgggcggcaaatcccgatgttctcaaggtcaaggggatg
gtcgaaaagcccaagacccaagacgcgccgtcgatgttcgcggccgcggggcgctatgtg
ctcgaccgcgccatcttcgatgcgctgcgccggatcgagcgcggcgccgggggtgaagtt
cagctcaccgacgcgatcgcgctgctgatcgccgaggggcatccggtccatgtcgtggtg
caccgcggatcccgacacgacttgggaaatcccggcggctacctcaaggctgcggttgac
tttgcattggatcgtgacgactacggcccggatttgcggcgatggttggtggcgcgattg
ggcctgaccgagcagtag

DBGET integrated database retrieval system