KEGG   Mycobacterium marinum: MMAR_4536Help
Entry
MMAR_4536         CDS       T00694                                 

Gene name
echA7
Definition
(RefSeq) enoyl-CoA hydratase
  KO
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mmi  Mycobacterium marinum
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mmi00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    MMAR_4536 (echA7)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    MMAR_4536 (echA7)
   00650 Butanoate metabolism
    MMAR_4536 (echA7)
  Lipid metabolism
   00071 Fatty acid degradation
    MMAR_4536 (echA7)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MMAR_4536 (echA7)
   00310 Lysine degradation
    MMAR_4536 (echA7)
   00360 Phenylalanine metabolism
    MMAR_4536 (echA7)
   00380 Tryptophan metabolism
    MMAR_4536 (echA7)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MMAR_4536 (echA7)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MMAR_4536 (echA7)
   00281 Geraniol degradation
    MMAR_4536 (echA7)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MMAR_4536 (echA7)
   00627 Aminobenzoate degradation
    MMAR_4536 (echA7)
   00930 Caprolactam degradation
    MMAR_4536 (echA7)
Enzymes [BR:mmi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MMAR_4536 (echA7)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5566705..5567478
Genome map
AA seq 257 aa AA seqDB search
MADRLVEYARDGVVARLTLNSPHNRNALSTTLVTQLHEGLRDAAADPGVRVVVLGHTGGT
FCAGADLTEAGSGDPYDLAVARAREMTTVLRAIVESPRPVIGAINGHVRAGGFGLVGACD
IVVAGPACTFALTEARIGVAPAIISLTLLPKLSARAAARYYLTGAKFGADEAAEMGLVTI
AADDVEAAVAALIADVGRGSPQGLAASKALTTAAVLAGFDRDAERLTEESARLFVSEEAR
EGMLAFLQKRQPSWASD
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atggctgatcgtctcgtcgagtacgcgcgtgacggcgtggttgcccgtctgacgctgaac
tccccgcacaaccgcaacgctttgtccaccaccctggtcacccagctgcatgaggggctg
cgggatgccgcggccgatccgggcgtgcgggtcgtcgtgctcgggcacaccggcggcacc
ttctgcgctggcgcggatttgaccgaggccggctccggcgacccctatgacctggctgtc
gcgcgggcccgggaaatgaccacggtgctgcgcgccattgtggagtcgccccgaccggtg
atcggcgccatcaacgggcacgtgcgcgccggaggcttcggcctggtcggtgcctgcgac
atcgtggtcgccggcccggcttgcacctttgcgctgaccgaagcccggatcggggtcgcc
ccggcaatcatctcgctgacattgctgccgaagctgtcggcgcgggcggccgcccgctac
tacctgaccggagcgaagttcggcgccgacgaggcggcggagatgggtttggtcaccatc
gccgccgacgacgtggaggccgcggtggccgcgctgatcgccgatgtggggcgcggttcg
ccgcagggccttgcggcgtcgaaggcactgaccaccgcggccgtactggccggtttcgac
cgtgatgcggaacgtctcaccgaggaatcggcgcggctgttcgtctcggaggaagcccgc
gaaggcatgctcgcgttcttgcagaaacgccaacccagctgggcctccgactga

DBGET integrated database retrieval system