KEGG   Mycobacterium marinum M: MMAR_5008Help
Entry
MMAR_5008         CDS       T00694                                 

Gene name
ltp3
Definition
(GenBank) lipid carrier protein or keto acyl-CoA thiolase Ltp3
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mmi  Mycobacterium marinum M
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Module
C5 isoprenoid biosynthesis, mevalonate pathway
Brite
KEGG Orthology (KO) [BR:mmi00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MMAR_5008 (ltp3)
   00630 Glyoxylate and dicarboxylate metabolism
    MMAR_5008 (ltp3)
   00640 Propanoate metabolism
    MMAR_5008 (ltp3)
   00650 Butanoate metabolism
    MMAR_5008 (ltp3)
  Lipid metabolism
   00071 Fatty acid degradation
    MMAR_5008 (ltp3)
   00072 Synthesis and degradation of ketone bodies
    MMAR_5008 (ltp3)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MMAR_5008 (ltp3)
   00310 Lysine degradation
    MMAR_5008 (ltp3)
   00380 Tryptophan metabolism
    MMAR_5008 (ltp3)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MMAR_5008 (ltp3)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MMAR_5008 (ltp3)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    MMAR_5008 (ltp3)
Enzymes [BR:mmi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     MMAR_5008 (ltp3)
Exosome [BR:mmi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MMAR_5008 (ltp3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
6081996..6083174
Genome map
AA seq 392 aa AA seqDB search
MAGARAQLAAVLGTGQTKYVAKRQDVSMNGLVREAIDRALQDSGSTFDDIDAVVVGKAPD
FFEGVMMPELFMADAMGASGKPLIRVHTAGSVGGSTGVVAASLVQSGKYRRVLAMAWEKQ
SESNAMWALSIPIPFIKPVGAGAGGYFAPHVRAYIRRSGAPSNIGAMVAVKDRLNGSRNP
LAHLQQPDITLDKVMQSPMLWDPIRYDETCPSSDGACAVVIGNEEIADTRVADGHPVAWI
HATALRTEPLAYSGRDQVSPQAGRDAAAALWKAAGITSPIDEIDAAEIYVPFSWFEPMWL
ENLGFMPEGEGWKLTEAGETAIGGRLPVNPSGGVLSSNPIGASGLIRFAEAAIQVMGKGG
DHQVPNARKALGHAYGGGSQYYSMWVVGADKP
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atggccggagcccgagcacagctggccgcggtactaggtaccggccagaccaagtatgtc
gccaagcgccaagatgtctcgatgaacggcctggtgcgcgaggctatcgatcgggcgctg
caagattccgggtcgacgttcgacgacatcgacgccgtcgtggtcggtaaggcgcccgat
ttcttcgagggcgtgatgatgccggagctgttcatggccgatgccatgggcgccagcggc
aagccgctgatccgggtgcacacggcgggctcggtgggcggatccaccggtgtggtggcg
gccagcctggtccagtccggcaagtatcgccgcgtgctggcgatggcgtgggagaagcag
tcggagtccaacgccatgtgggccttgtcgattccgattcccttcatcaaaccggtcggc
gccggtgccggcggctatttcgccccacacgtgcgcgcctacatccgccgctccggagct
ccgtcgaacatcggcgcaatggtcgcggtgaaggaccggctcaacggcagccgcaacccg
ctcgcacatctacagcagccggacatcaccctcgacaaggtgatgcaatcaccgatgttg
tgggacccgatccgctacgacgagacctgcccgtcgtcggacggcgcctgcgccgtggtg
atcggcaatgaggaaatcgccgatacgcgcgttgccgatgggcacccggtggcatggatc
cacgcgaccgcactgcgcaccgaaccgctggcatactccggacgcgaccaagtcagcccc
caggccggccgtgacgcggccgcggcgctgtggaaagcggccggaatcaccagtcctatc
gatgagatcgatgccgccgagatctatgtcccgttctcctggttcgaaccaatgtggttg
gaaaaccttgggttcatgcccgagggcgagggctggaagctcaccgaggccggtgagacc
gcgatcggcgggcggttgccggtgaacccgtccggcggcgtgctctcatccaaccccatc
ggcgcctcggggttgattcgcttcgccgaggcggctatccaggtgatgggcaagggcggc
gatcaccaagtgcccaatgcccggaaagccctgggtcacgcatacggcggcggctcgcag
tattactccatgtgggtggtgggggccgacaagccatga

DBGET integrated database retrieval system