KEGG   Mycobacterium marinum M: MMAR_5022Help
Entry
MMAR_5022         CDS       T00694                                 

Gene name
mhpF_1
Definition
(GenBank) acetaldehyde dehydrogenase, MhpF_1
  KO
K04073  acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
mmi  Mycobacterium marinum M
Pathway
mmi00360  Phenylalanine metabolism
mmi00362  Benzoate degradation
mmi00620  Pyruvate metabolism
mmi00621  Dioxin degradation
mmi00622  Xylene degradation
mmi00650  Butanoate metabolism
mmi01100  Metabolic pathways
mmi01120  Microbial metabolism in diverse environments
mmi01220  Degradation of aromatic compounds
Module
mmi_M00545  Trans-cinnamate degradation, trans-cinnamate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mmi00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MMAR_5022 (mhpF_1)
   00650 Butanoate metabolism
    MMAR_5022 (mhpF_1)
  Amino acid metabolism
   00360 Phenylalanine metabolism
    MMAR_5022 (mhpF_1)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MMAR_5022 (mhpF_1)
   00622 Xylene degradation
    MMAR_5022 (mhpF_1)
   00621 Dioxin degradation
    MMAR_5022 (mhpF_1)
Enzymes [BR:mmi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     MMAR_5022 (mhpF_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh GFO_IDH_MocA DUF4620
Motif
Other DBs
NCBI-ProteinID: ACC43426
UniProt: B2HI26
Position
complement(6097632..6098558)
Genome map
AA seq 308 aa AA seqDB search
MPSKASVAIVGSGNISTDLLYKLLRSDWLEPRWMVGIDPQSEGLARARKLGLETTHEGVD
WLLAQSDKPDLVFEATSAYVHKAAAPKYAAAGIRAIDLTPAAVGPAVVPPANLREHLDAP
NVNMITCGGQATIPIVYAVSRAVADLGGVPYAEIVASVASVSAGPGTRANIDEFTKTTSK
GVETIGGARRGKAIIILNPADPPMIMRDTIFCAIPEDADRDAIAASIHEVVAQVQTYVPG
YRLLNEPQFDEPSINSGGQAVVTTFVEVEGAGDYLPPYAGNLDIMTAAATKVGEEIAMQT
LAVSGGKR
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgccgtcgaaggcaagtgtggccattgttgggtccggaaatatcagcaccgacctgctc
tacaaactgctgcgatccgactggctggaaccgcgctggatggtggggatcgacccgcag
agtgagggtttggcgcgggcccgcaagttgggcctggagaccacccacgagggcgtggat
tggctgttggcccagtcggacaagcccgatctggtgttcgaggcgaccagtgcctatgtg
cacaaggcggcggcgccgaagtatgcggccgccggaatccgggcgattgacttgacgccg
gcggcggtgggtcccgcggtggttccgccggccaacctgcgcgagcacctggatgccccc
aacgtcaacatgatcacctgtgggggacaggcgaccattccgatcgtgtacgcggtgtcg
cgagcggttgccgatctgggcggggttccctacgccgagatcgtggcgtcggtggcctcg
gtctcggcagggcccgggacccgggccaacatcgacgagttcaccaagaccaccagcaaa
ggtgtcgagacgatcggcggcgcccggcgcggtaaggcgatcatcattttgaacccggcc
gatccgccgatgatcatgcgggacacgatcttttgcgccatccccgaagacgccgaccgc
gacgcgatcgcggcctcgattcatgaggtcgtggcccaggtgcagacctatgtgcccggg
taccggttgctcaacgagccgcagttcgacgagccgtcgatcaactccggtggccaggcg
gtggtgaccacgttcgtcgaggtcgaaggcgctggcgattatctgccgccctacgcgggc
aatctggacatcatgaccgcggcggcgaccaaggtcggcgaggagatcgccatgcagacg
ctggccgtgtcaggaggaaagcgatga

DBGET integrated database retrieval system