KEGG   Mycobacterium marinum M: MMAR_5111Help
Entry
MMAR_5111         CDS       T00694                                 

Gene name
folP1
Definition
dihydropteroate synthase 1 FolP1
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
mmi  Mycobacterium marinum M
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:mmi00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6189644..6190486)
Genome map
AA seq 280 aa AA seqDB search
MSSRPVQVMGVLNVTNDSFSDGGRYCDEAKAIEHGLALAAEGADIIDVGGESTRPGAARV
DPAVEASRVLPVIKELAARGIKVSIDTTRAAVACEALHNGAQIVNDVSGGRADPAMAPLV
AEAGVPWVLMHWRPVSDDNPHQVPNYRDVVAEVRAELLTAVDDAIAAGVGPSNLMIDPGL
GFAKAGQHNWTLLHALPELVATGIPVLVGASRKRFLGSLLAGPDGAVRPPDGRETATAVI
SALAALHGAWGVRVHDVRASVDALKVVDAWQRAERTGHDG
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
gtgagttcgcggcctgtgcaggttatgggcgtattgaatgtcacgaacgactcgttctcc
gacggtgggcgctactgcgacgaggccaaggccatcgagcacggtctggcgctggcggcc
gaaggtgcggacatcatcgacgtcgggggggagtcgactcggccgggcgccgcgcgggtt
gacccggccgtcgaggcgtcccgcgtcttgcccgtcatcaaagaactggccgcgcgcggt
atcaaggtcagcatcgacaccacccgcgcggccgtagcgtgcgaggcgctgcacaacggc
gcgcagatcgtcaacgacgtgtccggagggcgggccgatccggcaatggccccgctggtc
gccgaagccggtgtgccgtgggtgctgatgcactggcggccggtgtccgacgacaaccca
catcaggtgccgaactaccgcgatgtggtggccgaggtgcgcgccgagctgctcaccgcc
gtggatgatgcgatagccgcgggcgttggcccatcgaatctgatgatcgatcccggcctg
ggcttcgccaaggccggacagcacaattggacgctgctgcacgccctgccggagttggtc
gccaccgggatcccggtgctggtgggagcgtctcgaaagcgcttcctcgggtcgttgctg
gccggcccggatggtgcggtacggccgccggacgggcgggaaacggcgaccgcggtgatt
tccgcattggcggcgctgcacggcgcatggggtgtgcgggtgcatgatgtgcgggcttcc
gtcgacgccctcaaggtcgtcgacgcgtggcagcgggctgaaaggactgggcacgatggc
tga

DBGET integrated database retrieval system