KEGG   Mycobacterium marinum M: MMAR_5208Help
Entry
MMAR_5208         CDS       T00694                                 

Gene name
glpK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
mmi  Mycobacterium marinum M
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:mmi00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6292586..6294112)
Genome map
AA seq 508 aa AA seqDB search
MADSPDFVAAIDQGTTSTRCMIFDHQGAEIARHQLEHEQILPRAGWVEHNPVEIWERTAS
VLMSVLNATDLSPKNIAALGITNQRETTLVWNKRTGRPYYNAIVWQDTRTDRIASALDRD
GRGDVIRRKAGLPPATYFSGGKLQWILENVDGVRAAAERGDALFGTPDTWVLWNLTGGPR
GGVHVTDVTNASRTMLMNLETLDWDDELLSFFSIPRAMLPAIEPSSPLQPYGITQDTGPV
GGEVPITGMLGDQHAAMVGQVCLDAGEAKNTYGTGNFLLLNTGETIVRSSNGLLTTLCYQ
FGDAKPVYALEGSIAVTGSAVQWLRDQLGIISGASQSEALARQVSDNGGVYFVPAFSGLF
APYWRSDARGAIVGLSRFNNNAHLARATLEAICYQSRDVVDAMEADSGVRLEVLKVDGGI
TSNDLCMQIQADVLGVDVVRPVVAETTALGAAYAAGLAVGFWADPSDLRANWQEDKRWTP
QWTDDQRAAGYAGWRKAVQRTLDWVDVS
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
gtggccgattcccctgactttgtagcagccatcgaccagggcaccaccagcactcgctgc
atgatcttcgaccaccaaggcgccgagatcgcccgtcaccaactcgagcacgagcagatc
ctgccccgcgccggctgggtggaacacaacccggtggaaatctgggaacgcaccgcctcg
gtgctgatgtcggtgctcaacgccaccgatttgtcgccgaaaaatattgccgcactggga
atcacgaatcaacgtgaaaccacgctggtgtggaacaagcgaaccggcaggccctactac
aacgcgatcgtctggcaggacacccgcaccgatcgcatcgcctcagcgctggaccgtgac
ggtcgcggtgacgtgatccgccgcaaagcgggattgcccccggcgacctatttctcgggc
ggcaagctgcagtggattctggagaacgtcgacggggtgcgcgccgccgccgaacgcggt
gatgccctcttcggtaccccggacacctgggtgctgtggaacttgaccggcggcccgcgc
ggcggcgtgcacgtcaccgatgtgaccaacgccagccggaccatgctgatgaacctggaa
accctggactgggacgacgagctgctgtcgttcttttccatcccccgcgcgatgctgccc
gcgatcgagccgtcgtcgccgctgcagccctacggcatcacccaggacaccggtccggtc
ggcggtgaggtacccatcaccggcatgctcggcgaccagcacgcggccatggtcggccag
gtgtgtctggacgcgggcgaggcgaaaaacacctacggcaccggcaactttctcctgctg
aacaccggcgagaccatcgtgcgatccagcaacggcctgctgaccaccctgtgctaccaa
ttcggcgatgccaaacccgtgtacgcgctggaagggtcgatagccgtaaccggctccgcg
gtgcagtggctacgcgatcagttgggcatcatcagtggcgcctcgcagagcgaggcgctg
gcccggcaggtctccgacaacggcggggtgtacttcgtgccggcattctcgggcctgttc
gcaccgtattggcgctccgatgcgcgcggggcgatcgtggggctgtcgcggttcaacaac
aacgcccacttggctcgcgcgacgctggaagcgatctgctaccagagccgcgatgtggtg
gacgccatggaagccgactcgggcgtgcgacttgaggtgctcaaggtcgacggcggcatc
accagcaatgacttgtgcatgcagatccaggccgacgtgctcggggtggacgtggtgcgg
ccggtggtcgccgagaccaccgcgctgggcgccgcctatgcggcggggctggccgtcggt
ttctgggccgatccgtcggacctgcgggccaactggcaagaggacaagcgctggacgccg
cagtggaccgatgaccagcgcgccgccggatatgccggttggcgcaaggccgtgcagcgg
accttggactgggtcgacgtgtcctag

DBGET integrated database retrieval system