KEGG   Mycobacterium marinum M: MMAR_5231Help
Entry
MMAR_5231         CDS       T00694                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
mmi  Mycobacterium marinum M
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:mmi03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6321291..6321902)
Genome map
AA seq 203 aa AA seqDB search
MFEGPVQDLIDELGKLPGIGPKSAQRIAFHLLSVEPPDIDRLTAVLAKVRDGVRFCAVCG
NVSDDERCRICADPRRDGSLVCVVEEPKDIQAVERTREYRGRYHVLGGALDPLSGIGPEQ
LRIRELLTRIGDRVDGVDITEVIIATDPNTEGEATATYLVRMLRDIPGLTVTRIASGLPM
GGDLEFADELTLGRALTGRRAMV
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgttcgagggacccgttcaggatctgatcgacgagctcggcaagctgccgggcatcggc
cccaagagtgcccagcgcatcgcgtttcacctcttgtcggttgagccgccggacatcgac
cggctgaccgccgtgctggccaaggtccgggacggggtgcgcttctgcgctgtgtgcggg
aacgtctccgatgacgagcgttgccgcatttgcgcggacccgcgccgggacgggtccctg
gtctgcgtcgtcgaagagcccaaagacatccaggccgtcgagcgaacccgcgaataccgc
ggtcgctatcacgtgctgggcggggcgctcgatccgctttccgggatcggtcccgagcag
ctgcgaatccgcgagttgctgactcgcatcggtgatcgggtcgacggcgtcgatatcacc
gaggtgatcatcgccaccgaccccaataccgagggcgaggcgacggccacctacctggtg
cggatgctgcgcgacatccccggcctgaccgtcacccggatcgcgtcggggctgccgatg
ggtggtgacctggagttcgccgacgaactcaccctgggccgcgcgttgaccggccgccgc
gcgatggtctga

DBGET integrated database retrieval system