KEGG   Mycobacterium marinum: MMAR_5329Help
Entry
MMAR_5329         CDS       T00694                                 

Gene name
echA21
Definition
(RefSeq) enoyl-CoA hydratase
  KO
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mmi  Mycobacterium marinum
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mmi00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    MMAR_5329 (echA21)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    MMAR_5329 (echA21)
   00650 Butanoate metabolism
    MMAR_5329 (echA21)
  Lipid metabolism
   00071 Fatty acid degradation
    MMAR_5329 (echA21)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MMAR_5329 (echA21)
   00310 Lysine degradation
    MMAR_5329 (echA21)
   00360 Phenylalanine metabolism
    MMAR_5329 (echA21)
   00380 Tryptophan metabolism
    MMAR_5329 (echA21)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MMAR_5329 (echA21)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MMAR_5329 (echA21)
   00281 Geraniol degradation
    MMAR_5329 (echA21)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MMAR_5329 (echA21)
   00627 Aminobenzoate degradation
    MMAR_5329 (echA21)
   00930 Caprolactam degradation
    MMAR_5329 (echA21)
Enzymes [BR:mmi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MMAR_5329 (echA21)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6435011..6435835
Genome map
AA seq 274 aa AA seqDB search
MGETYESVTVEIKDQVAQVTLIGPGKGNAMGPAFWSELPEVFAALDADRDVRAIVITGSG
KNFSYGLDVPAMGGTFAPLMAEGALARPRTDFHAEVLRMQKATNAVADCRTPTIASVHGW
CIGGGVDLISAVDMRYASADAKFSIREVKLAIVADMGSLARLPMILNDGHLRELALTGRD
IDAARAEKIGLVNQVFEDADATLAAAHATATEIAANPPLAVYGVKDVLDQQRASAVAENL
RYVAAWNAAFLPSKDLTEGISATFAKRPPQFTGE
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgggcgaaacatacgaatctgtcaccgtcgagatcaaagaccaggtcgcacaggtgacg
ttgatcgggccgggcaagggtaatgcaatgggacccgctttctggtcggagctgccggaa
gtcttcgcggcgctggacgccgaccgtgatgtgcgggcgatcgtcatcaccgggtcgggc
aagaacttcagttacggactggacgtgccggcgatgggtggaactttcgccccgctgatg
gccgaaggggcgctggcgcgtccccgcaccgactttcatgccgaggtgctgcggatgcag
aaggcgaccaatgcggtcgccgattgccggaccccgaccatcgcgtcggtgcacggctgg
tgcattggcggcggcgtcgacctgatctcggcggtggacatgcgctacgcgagtgcggat
gcgaagttctcgatacgcgaggtcaagctcgccatcgtcgccgacatgggcagcctggcc
cgccttccgatgatcctcaacgacggtcatctgcgggagctggcgctgaccggtcgggat
atcgacgccgctcgggccgagaagatcggcctggtcaaccaggtgttcgaagacgccgac
gcaaccttggccgccgcccacgccaccgccaccgagattgccgccaatcccccgctggcg
gtgtacggcgtcaaagacgtcctcgaccagcagcgcgcgtcggccgtcgcggaaaacctg
cgctacgtcgcggcctggaatgcggcgtttctgccgtccaaggacctcaccgagggaata
tcggcgaccttcgccaagcggcctccccagttcaccggggagtag

DBGET integrated database retrieval system