KEGG   Morganella morganii: MU9_1461Help
Entry
MU9_1461          CDS       T02496                                 

Definition
(GenBank) GTP cyclohydrolase I type 1
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
mmk  Morganella morganii
Pathway
mmk00790  Folate biosynthesis
mmk01100  Metabolic pathways
Module
mmk_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:mmk00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    MU9_1461
Enzymes [BR:mmk01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     MU9_1461
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF
Motif
Other DBs
NCBI-ProteinID: AGG30507
UniProt: J7TRM1
Position
1657316..1657975
Genome map
AA seq 219 aa AA seqDB search
MSSLSREAELVHAALIARGLETPLREQTLPPETRKVQIEAHMTEIMKLLNLDLSDDSLAD
TPKRIAKMYVDEIFSGLDYHNFPKITLIENKMKVDEMVTVRDITLTSTCEHHFVTIDGKA
TVAYIPKDTVIGLSKINRIVQFFAQRPQVQERLTQQILLALQTLLGTTNVAVSIDAVHYC
VKARGIRDATSTTTTTSLGGLFKSSQNTRQEFLRAARHI
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcattaagccgggaagcagaacttgtccacgccgcgctcatcgcacgcgggctg
gagacaccattgcgggagcagacactgccgccggaaacccgcaaggttcagattgaagcg
catatgacagaaattatgaagctgctcaatctcgacctgagcgacgacagtctggcagat
accccgaaacgtatcgcgaagatgtatgtggatgaaattttttcaggactggattatcac
aatttcccgaaaatcaccctgattgaaaataaaatgaaagtggatgaaatggtgacggtc
cgtgatatcacgctgaccagcacctgtgaacaccactttgtcactatcgacggtaaagcc
accgttgcttatatcccgaaagacaccgttatcgggttatcgaaaattaaccgcattgtg
cagttctttgcccagcgcccgcaggttcaggaacgtctgacacagcaaattctgctggca
ctgcaaacgctgctcggcaccactaatgtggcggtatccattgacgcggtgcattattgt
gtcaaagcgcgcggcatccgtgacgcaaccagtaccaccaccaccacctcactgggcggg
ttatttaaatccagccagaatacccgccaggaattcctgcgcgcggcccgtcatatttaa

DBGET integrated database retrieval system