KEGG   Morganella morganii: MU9_2315Help
Entry
MU9_2315          CDS       T02496                                 

Definition
Alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
mmk  Morganella morganii
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mmk00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    MU9_2315
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MU9_2315
   00620 Pyruvate metabolism
    MU9_2315
   00650 Butanoate metabolism
    MU9_2315
  Lipid metabolism
   00071 Fatty acid degradation
    MU9_2315
  Amino acid metabolism
   00350 Tyrosine metabolism
    MU9_2315
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    MU9_2315
   00626 Naphthalene degradation
    MU9_2315
Enzymes [BR:mmk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     MU9_2315
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     MU9_2315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2549296..2551956
Genome map
AA seq 886 aa AA seqDB search
MAVTNVTELNELVVRVKKAQREFAGFSQEQVDAIFRAAALAAADARIPLAKLAVEESGMG
IIEDKVIKNHFASEYIYNAYRDEKTCGILSEDPTFGTITIAEPIGIICGIVPTTNPTSTA
IFKALISLKTRNGIIFSPHPRAKKATNRAAEIVLNAAVAAGAPKDIIGWIDEPSVELSNA
LMHHADTNLILATGGPGMVKAAYSSGKPAIGVGAGNTPVVIDETADIKRAVASILMSKTF
DNGVICASEQSVIVVDDVYEQVKERFETHGGYILKGKELKAVQDIILLNGGLNAKIVGQS
AVKIAEMAGIEVPAWTKILIGAVSVVDESEPFAHEKLSPLLAMYRGKDFEDAVIKAEKLV
EMGGIGHTSCLYTDQDNQPERVKFFGEKMKTARILINTPASQGGIGDLYNFKLSPSLTLG
CGSWGGNSISENVGPKHLINTKTVAKRAENMLWHKLPKSIYFRRGSLPVALEEIAGDGAK
RAFIVTDGYLFNNGYVDEVTRVLKSYGMEVEIFFEVEADPTLSVVRKGAEQMNSFKPDVI
IALGGGSPMDAAKIMWVMYEHPETHFEELALRFMDIRKRIYKFPKMGVKAKMVAITTTSG
TGSEVTPFAVVTDDTTGQKYPLADYALTPDMAIVDANLVMNMPKSLTAFGGLDAVTHALE
AYVSVLANEFSDGQALQALKLLKEFLPASYHEGAKNPVARERVHNAATIAGIAFANAFLG
VCHSMAHKLGSEFHIPHGLANALLICNVIRYNATDNPTKQTAFSQYDRPQARRRYAEIAD
HLQLSAAGDRTAQKIEKLLIWLDEIKASLGIPKSIREAGVPEAEFLAKLDKLSEDAFDDQ
CTGANPRYPLIAELKQIMLDTYYGRTYDESVPVAAPKPIAKRNAKK
NT seq 2661 nt NT seq  +upstreamnt  +downstreamnt
atggccgtaacgaacgttaccgaactcaatgaattagttgtccgcgtgaagaaagctcag
cgcgagtttgccggtttctcccaggaacaggtggatgctatcttccgggccgcggcactc
gccgcagcagatgcccgtatcccgctggcaaaactggcggttgaagagtccggcatgggt
attattgaagataaagtgatcaaaaaccattttgcttctgaatatatctataacgcctac
cgcgatgagaaaacctgcggcatcttatcggaagacccgaccttcggcaccatcaccatc
gcagaacctatcggtattatctgcggtatcgtcccgaccactaacccgacctccaccgca
atttttaaagcgctgatcagcctgaaaacccgtaacgggatcattttctccccgcatccg
cgtgcgaaaaaagccaccaacagagcagcagagattgtcctcaacgcggctgttgccgcc
ggtgccccgaaagatattatcggctggatcgacgagccgtcagtggaattgtccaatgcc
ctgatgcatcacgctgataccaacctgatcctcgccaccggcgggccgggcatggtgaaa
gccgcctacagttccggtaaaccggccattggtgtgggcgcgggtaacacccctgtcgta
attgatgaaaccgctgatatcaaacgcgcggtggcctctattctgatgtcaaaaaccttc
gataacggcgtgatttgtgcctctgagcaatcggttatcgtagtggatgatgtgtatgag
caggtcaaagaacgttttgaaacccacggcggttatattctgaaaggcaaagagctgaaa
gccgttcaggacatcattctgctcaacggcggactgaatgcgaaaattgtcggtcagtct
gcggtgaaaattgctgaaatggccggtatcgaagtacctgcctggaccaaaattcttatc
ggtgcggtctccgtagtggatgaatccgagccgtttgcacacgaaaaactctccccgctg
ttagccatgtaccgcggcaaagattttgaagacgcggtgatcaaagcggaaaaactggtg
gaaatgggcgggatcggccacacctcctgcttatataccgatcaggacaaccagccggag
cgcgtgaaattcttcggtgagaagatgaaaaccgcacgtatcctgattaacaccccggca
tcacagggtgggatcggcgacctgtataacttcaaactgtctccgtcactgacactgggt
tgcggctcctggggtggtaactccatttccgaaaacgtcggaccgaaacatctgatcaac
accaaaaccgtggcaaaacgagctgaaaatatgttgtggcataaacttccgaaatctatc
tatttccgccgtggttctctgccggttgccctggaagagatcgccggtgacggtgcaaaa
cgcgcctttatcgtgactgacggctatctgttcaataacggctatgtggatgaagtcacc
cgtgtgctgaaatcctacggtatggaagtggaaattttctttgaagtggaagctgacccg
acactttctgtggtccgcaaaggcgcagagcaaatgaacagcttcaaaccggacgtgatt
attgccctcggcggcggctccccgatggatgcagccaaaattatgtgggtgatgtatgag
catccggaaacccattttgaggaactggcactgcgctttatggatatccgtaaacgtatc
tataagttcccgaaaatgggcgtgaaagcaaaaatggttgctatcaccaccacatccggt
accggttctgaagtgactccgtttgcagttgtgacagatgataccaccggccagaaatac
ccgctggcggactatgcgctgaccccggatatggcgattgttgatgccaacctggtgatg
aacatgccgaaatccctcaccgcgttcggcgggctggatgcggtcactcacgcactggaa
gcgtatgtatccgtgctggcaaacgaattctctgacggccaggcattacaggcgctgaaa
ctgctgaaagagtttttaccggccagctatcacgaaggtgcgaagaacccggttgcccgt
gaacgcgtacataatgccgcgactatcgccggtatcgcgtttgccaacgccttcctcggg
gtatgtcactccatggcgcacaaactgggctctgagttccatattccgcacggtctggct
aatgccctgctcatctgtaacgtcatccgttataacgctaccgataacccgaccaaacag
actgcgttcagccagtatgaccgtccgcaggcgcgccgccgttacgcggagattgctgac
catctgcaactgagtgctgccggtgaccgtaccgcgcagaagattgaaaaactgctgatc
tggctggatgaaatcaaagcatctctggggatcccgaaatccatccgtgaagccggtgtg
ccggaagccgaattcctggcaaaactggataaactgtccgaagatgcctttgatgaccag
tgtaccggtgcaaacccgcgttatccgctgattgcagaattaaaacaaatcatgctggat
acctattacggacgcacctatgacgaatctgttcctgttgcggcgccaaaaccgattgcc
aaacggaatgctaagaaataa

DBGET integrated database retrieval system