KEGG   Morganella morganii: MU9_2316Help
Entry
MU9_2316          CDS       T02496                                 

Definition
Thymidine kinase
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
mmk  Morganella morganii
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:mmk00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2552306..2552929)
Genome map
AA seq 207 aa AA seqDB search
MCKGREPVAQLYFYYSAMNAGKSTALLQSSYNYNERGMRTLIFTAEIDNRYEQSKVTSRI
GLSADARVFGPETDVSSVIIREHQQTPVHCVLIDECQFLTKAQVEQLCCIVDDIDIPVLC
YGLRTDFKGELFSGSHYLLAWADKLVELKTICYCGRKASRVLRYDGQGRVMSDGAQIDIG
GNEKYVSVCRKHYNEAIREVKAAEYRS
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgtgtaaggggagagagccggtggctcagctttatttttattactccgcaatgaatgcg
ggaaaatcgacagcgttactgcagtcatcctataactacaatgaacgcggcatgcgcacg
ctgatatttaccgcagagatagacaaccgctatgagcagagcaaagtcacctcacgtatc
ggcctgagcgccgatgcacgggtctttggccctgagacggacgtcagctcggttattatc
cgtgaacatcagcagacacccgtacactgcgtattaatcgatgaatgccagttcctgacc
aaagcacaggtggaacagctctgctgtatcgtcgacgatattgatatcccggttctgtgt
tacgggttacgcacagactttaaaggtgagttattcagcggcagccattatttattagcc
tgggcggataaattagttgaattaaaaactatttgttattgcggacgaaaagccagccgt
gttttacgttacgacggacaggggcgggttatgtcagatggtgcacaaattgacatcggc
ggtaatgaaaaatatgtatccgtctgccgcaaacattacaatgaagcgatacgcgaagta
aaagcagcagaatatcggtcataa

DBGET integrated database retrieval system