KEGG   Morganella morganii: MU9_2560Help
Entry
MU9_2560          CDS       T02496                                 

Definition
Aspartate aminotransferase
Orthology
K14260  
alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
mmk  Morganella morganii
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mmk00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    MU9_2560
   01230 Biosynthesis of amino acids
    MU9_2560
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MU9_2560
   00290 Valine, leucine and isoleucine biosynthesis
    MU9_2560
Enzymes [BR:mmk01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     MU9_2560
    2.6.1.66  valine---pyruvate transaminase
     MU9_2560
Amino acid related enzymes [BR:mmk01007]
 Aminotransferase (transaminase)
  Class I
   MU9_2560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2809442..2810656
Genome map
AA seq 404 aa AA seqDB search
MNIIKKSSKLDNVCYDIRGPVLKEAKRLEEEGQKVLKLNIGNPAPFGFDAPDEILVDVIR
NLPSSQGYSDSKGLYSARKAIVQFYQERGMRDMTVEDVYIGNGVSELIVQSMQALLNNGD
EMLVPAPDYPLWTGAVSLSGGTAVHYMCDEEQGWMPDIEDIKKKITPRTRGIVVINPNNP
TGAVYSKDLLQEIVELARQNDLIIFADEIYDKILYDDAVHHSIAAMAPDLLTVTFNGLSK
TYRIAGFRQGWMVLNGPKKHAKGYIEGLEMLASMRLCANVPMQHAIQTAIGGYQSINEFI
HPGGRLYEQRNKAWELINQIPGCSCVKPMGALYMFPKFDAKRFNIHDDQKMILDLLLQEK
VLLVQGTAFNWPEPNHFRIVTLPREDDLEMAINRFGRFLSHYRQ
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaatataataaagaaatccagcaaactcgataatgtctgttacgacattcgcgggccg
gtgctcaaagaggctaaacgtctcgaagaggaaggccagaaagttctcaaactgaatatc
ggtaacccggcgccgtttggttttgatgccccggacgaaattctggttgatgttatccgt
aatttaccaagctcccagggttacagcgattcaaaaggcctctattccgcccgtaaagcc
attgtccagttctaccaggaacgcggcatgcgcgatatgacggtggaagatgtctatatc
ggtaacggggtttctgaactgattgtgcagtccatgcaggcgctgctgaataacggtgat
gaaatgctggtaccggcaccggattacccgttatggaccggtgcggtctccctctccggc
ggtactgccgtccactatatgtgcgacgaagaacagggctggatgccggacattgaggac
atcaaaaagaaaatcaccccgcgcacccgcggtattgtggtgattaacccgaacaacccg
accggggctgtttacagcaaagatttgttacaggagattgtcgaactcgcccgtcagaat
gacctgatcatttttgctgacgaaatctacgacaaaattctgtatgacgatgccgtccac
cactctatcgccgcaatggcgccggatctgctgaccgtcaccttcaacggcctgtcaaaa
acctaccgtatcgccggtttccgccagggctggatggtcctgaacgggccgaagaaacac
gccaaagggtatattgaagggctggaaatgctcgcgtccatgcgtctgtgtgccaacgtg
ccgatgcagcatgctatccagaccgcaatcggcgggtaccagagcatcaatgagtttatt
catccgggcggccgtctgtatgaacagcgcaacaaagcctgggaactgattaaccagata
ccgggctgctcctgtgtcaaaccgatgggcgcactctatatgttcccgaaatttgatgcc
aagcgctttaatattcacgatgaccagaagatgatcctcgacctgctgttacaggaaaaa
gtactgctggtacagggtactgcctttaactggccggaaccgaaccacttccgtatcgtg
acactgccgcgtgaggatgacctggagatggcgattaaccgcttcgggcgtttcctctct
cactaccgtcagtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system