KEGG   Morganella morganii: MU9_3010Help
Entry
MU9_3010          CDS       T02496                                 

Definition
Thiol disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
mmk  Morganella morganii
Brite
Enzymes [BR:mmk01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     MU9_3010
Secretion system [BR:mmk02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   MU9_3010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3209376..3210068)
Genome map
AA seq 230 aa AA seqDB search
MLKIVSSALALLLVFSHGAVAGESEIKAALGKMDMTATMIRPSPVPGVSAVATPQGVFYI
SDDGRYLLQGPMFDMSGKTPKNITNNVLLDELNSLENEMIIYKSQRGSHVITVFTDITCP
YCLKLHNENKALNDKGITVRYLAFPRKGPDSAVGREMQSVWCNGFKTKALDNAFRNEPIP
QIDSCNIDISKHYNLGLKFGITGTPAIVLEDGTLIAGYLSADKIAELVNK
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgctgaaaattgtatcatccgcactggcgcttctgcttgtgttcagtcacggcgcggtt
gccggggaaagcgaaatcaaagcggcactgggcaaaatggatatgaccgccaccatgatc
cgcccgtcaccggtgccgggtgtctcggcggtagccaccccgcagggtgttttttatatc
agcgatgacggccgttatctgctgcaggggccgatgtttgatatgagcggcaaaaccccg
aaaaatatcaccaataatgtgctgctggatgagctgaacagcctggaaaatgagatgatc
atttataaatctcagcgcggcagccacgttattactgtctttacggatatcacctgtccg
tactgcctgaagttacataatgaaaataaggcgctgaatgataaaggcattacggtccgt
tatctggcgtttccgcgcaaagggccggattcagctgtcggccgggaaatgcagtcagtc
tggtgtaacgggttcaaaaccaaagcgctggataacgcgttccgtaatgaacctatcccg
cagatagacagctgtaacattgatatcagtaaacactataatctcggcctgaaattcggc
atcaccggcactccggcgattgtccttgaggacggaacgctgattgccggttacctgtca
gcggataaaattgctgaattagtaaataaataa

DBGET integrated database retrieval system