KEGG   Morganella morganii: MU9_3121Help
Entry
MU9_3121          CDS       T02496                                 

Definition
L-fuculose phosphate aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
mmk  Morganella morganii
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mmk00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    MU9_3121
Enzymes [BR:mmk01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     MU9_3121
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3334339..3334986
Genome map
AA seq 215 aa AA seqDB search
MTRTELAQQIIDTCLKMNASGLNQGTSGNVSARWQDGMLITPSGVPYEKLTPDSIVYMDS
TGQAEADKIPSSEWHFHLSCYQARPELNAVVHNHALNTAAVSILNESIPAIHYMVAVTGT
DHIPCVPYATFGTHELADIVAEGIKTSKALIMQHHGMLAMEINLEKALWLAHEVEVLSAL
YLKVRAITPDVPVLSAEEMQRVLGKFKTYGLKTGK
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgacccgtactgaactggcacaacagattatcgatacctgtctgaagatgaacgcaagc
gggctcaaccaggggacgtccggtaatgtcagcgcccgctggcaggacggcatgctgatc
actccgagcggcgtgccttatgaaaaactgaccccggacagcattgtgtatatggacagt
accggccaggcagaggcggataaaatcccgtcgagcgaatggcactttcacctgagctgc
tatcaggcgcgtcctgagctgaatgcggtggtccataatcacgctctgaatacagcggcg
gtatccattctcaatgaatccattccggcgatccattatatggtcgccgtgaccggaacc
gaccatatcccctgtgtgccgtatgccaccttcggcacacacgaactggctgatattgtt
gcggaagggattaaaaccagtaaagcgctgattatgcagcatcacggcatgctggcgatg
gaaatcaacctcgaaaaagccctgtggctggcgcatgaagttgaagtgctctccgcgctg
tatctgaaagtccgcgccatcacgccggatgtaccggtactgagtgcggaggagatgcag
cgggtgctggggaaattcaaaacctacggactgaaaaccggaaaatag

DBGET integrated database retrieval system