KEGG   Morganella morganii: MU9_454Help
Entry
MU9_454           CDS       T02496                                 

Definition
Ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
mmk  Morganella morganii
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:mmk00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    MU9_454
Enzymes [BR:mmk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     MU9_454
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(506797..507723)
Genome map
AA seq 308 aa AA seqDB search
MTTSRLTVLGSINVDHIMNIAQFPAPGETVIGKQYQTAFGGKGANQAVACGRSGADITFI
ACVGDDAIGVEILAQLQRDRIHTAAVSVVPEAATGVAMIFVNEDGENVIGISAGANAALT
PAHFAPYKGLVEQSDALLMQLESPLETVIAAAQAAKNHQTRVILNPAPARELPDSLLKLV
DVITPNETEAEKLTGISVSDETGAARAAQVLHDKGIGQVLITLGSRGVWLSVNGEGRRIP
GFKVNAVDTIAAGDTFNGAYVTALLEGKPADEAVRFAHAAAAIAVTRRGAQPSVPWRREI
DAFLAERG
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgacaacatcccgtctgaccgttctcggcagtattaatgtcgatcatattatgaatatt
gcacagttcccggcacccggcgaaacggtgatcggtaagcaatatcagacagccttcggc
ggcaaaggcgcgaatcaggcggtggcctgcggacgcagcggtgctgatattacctttatt
gcctgtgtgggggatgatgccatcggtgtggaaatcctggcgcagctgcagcgcgaccgt
attcacaccgccgcagtcagcgtggtaccggaagcggctaccggtgtggcgatgattttt
gtgaatgaagacggtgaaaacgtcatcggcatcagtgccggtgccaatgccgcgctgaca
ccggcacattttgcgccttataaagggctcgttgagcaatccgatgccctgctgatgcag
ctggagtccccgctggaaacggtgattgccgccgcacaggctgcaaaaaatcatcagacc
agagtgatcctcaatccggccccggcgcgggagttaccggacagcctgctgaagctggtg
gatgttatcaccccgaatgaaaccgaagcggaaaagctgaccggtatttctgtcagtgat
gaaaccggcgcagccagagcggcgcaggtactgcatgataaaggtatcggacaggtactg
atcaccctgggcagccgcggtgtctggctgagcgtaaacggtgaaggccgccggatcccg
ggctttaaagttaatgcggtggacactatcgcagccggcgatacctttaacggcgcgtat
gtcacggcgctgctggaaggaaaaccggcagatgaagcggtgcgttttgcccatgccgct
gccgcaattgctgtcacccgccggggtgctcagccatcggtgccgtggcgccgtgaaatt
gatgcattccttgcggagcgtggttaa

DBGET integrated database retrieval system