KEGG   Morganella morganii: MU9_782Help
Entry
MU9_782           CDS       T02496                                 

Definition
Alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
mmk  Morganella morganii
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:mmk00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    MU9_782
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    MU9_782
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    MU9_782
Enzymes [BR:mmk01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     MU9_782
Exosome [BR:mmk04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MU9_782
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
875394..876830
Genome map
AA seq 478 aa AA seqDB search
MLHATMKTRVAAAVLALLTGSALPAVAAGNADAILAQDRAAKGNITEFGGARRLSSDQTE
ALKAAIGQTKAKNVILFIGDGMGDSEITVARNYAEGAGGVFKGIDSLPLTGQYTTYALDK
KTQKPNYVTDSAASATAWASGVKTYNGALGIDVTGKPHTTILELAKKNGKATGNVTTSEI
QDATPAALISHISQRKCYGPEETAERCSADALENGGLGSISEQLLNARADVTLGGGAKSF
RQTAKAGDYAGKTLEEQAAARGYLVVKDAKSLADVKAANQDKPVLGLFSDGNMEVAWEGP
KASYRGNLDKPVVECKPSSKLDPNAPTLAQMTEKAIDLLKDHENGFFLQVESASIDKQDH
AANACGQIGETVALDEAVQIGMEYAKKHGDTLVIVTADHAHSSQIIEADVVSPGLTQALL
TKDGSVMAVNYGNSESDSQEHTGAQLRVAAYGPGAANVVGLTDQTDLFFTMRDAMELK
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgcttcatgcgacgatgaaaacacgggttgcagctgccgttctggcactgctgacaggc
tctgcattaccggcagttgcagcggggaatgcagatgccattctggcacaggatcgcgcc
gccaaaggcaatatcacggagttcggcggtgcgcgacgtctgtcatccgatcagactgag
gcgctgaaagcggctatcggtcagaccaaagcaaaaaatgtgattctgtttatcggcgac
ggtatgggggattccgaaattaccgtggcgcgtaactatgcagaaggcgcgggtggcgtg
tttaaaggaattgattccctgccgctgaccggccagtacaccacgtatgcgctcgataag
aaaacacagaaaccgaattatgttactgattctgctgcctctgcgactgcctgggcttcc
ggggtgaaaacctataacggtgcgctgggcatcgatgttaccggcaaaccgcacaccacc
attctcgagctggcaaagaaaaacggcaaagcgaccgggaatgtcaccacatctgaaatt
caggatgccacacccgctgcactgatctcacatatcagccagcgtaaatgctacggcccg
gaagaaaccgcagagcgctgcagtgcagatgcgctggaaaacggcggattgggctccatc
agtgaacaactgctgaatgcccgtgcggatgtcacgctcggcggcggtgcgaagagtttc
cgccagacagccaaagccggggactatgcaggtaaaaccctggaagagcaggcagcggca
cgcggttatctggttgtgaaagatgccaaatcgctggcggatgtgaaagcggcaaatcag
gataaaccggtgctcggattattcagtgacggcaatatggaagtggcgtgggaaggtccg
aaagcctcctaccgcggcaacctcgacaaacctgtcgtggagtgtaagccaagttcaaaa
ctggatccgaatgctccgacactggctcagatgactgaaaaagccattgatctgcttaaa
gatcatgaaaacggcttcttcttacaggtggaaagcgcctctatcgataaacaggatcac
gcggcaaacgcctgcggccagatcggcgaaaccgttgcactggatgaagcggtacaaatc
ggtatggaatacgcgaaaaaacatggtgatacgctggtgattgtgaccgctgatcatgct
cattccagccagattattgaagcggatgtagtctcaccgggtctgactcaggcactgctg
accaaagacggcagcgtgatggcagttaactacggtaactcggaatcagattcgcaggag
cataccggtgcccagctgcgtgtggcggcatacggtccgggggcggcgaatgtggtgggt
ctgacggatcagacagatttgttcttcaccatgcgggacgcgatggagctgaagtaa

DBGET integrated database retrieval system