KEGG   Morganella morganii: MU9_795Help
Entry
MU9_795           CDS       T02496                                 

Definition
Thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
mmk  Morganella morganii
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmk00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    MU9_795
Enzymes [BR:mmk01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     MU9_795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
890097..891419
Genome map
AA seq 440 aa AA seqDB search
MFLAQEIIRKKRDGHPLSDEEIRFFINGVRDNSVSEGQIAALAMTIYFHDMNPQERVSLT
LAMRDSGSVLDWKNLDLPGPVVDKHSTGGVGDVTSLMLGPMVAACGGYIPMISGRGLGHT
GGTLDKLEAIPGFDIFPDDETFRRIIKETGVAIIGQTNSLAPADKRFYATRDITATVDSI
PLITASILGKKLAEGLDALVMDVKVGSGAFMPTYELSEQLAQAIVQVANGAGCRTTALLT
DMNQVLASSAGNAVEVREAVRFLTGEYRNPRLYEVTMALCKEMLVSGGLAADRTEAEAKL
QQVLDNGKAAEIFGRMVAAQRGPADFIERYSHYLPSAVLSKPVYAETEGIVTAMDTRALG
MAVVSLGGGRRKASDPIDYSVGLSDIAPINSVADGQMPLAMIHANNEDAWNEAAQAVRRA
VTLSESPVTDTPLIYRRISE
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
gtgtttctggctcaggaaatcattcgcaaaaaacgggacggacacccgctctctgatgaa
gaaatccgtttctttattaacggcgtgcgtgataactcagtctctgagggacaaattgcc
gcgctggcgatgaccatatatttccatgatatgaacccgcaggaacgcgtctcactgaca
ctggcgatgcgggattccggctcggtgctggactggaaaaaccttgatttaccgggcccc
gttgtggataaacactccaccggcggcgtgggggatgtgacctccctgatgctcgggccg
atggtggctgcctgcggcggctatatcccgatgatctccggccgcggcctgggacatacc
ggcggcacgctcgacaaactggaagcgattccgggctttgatattttcccggatgatgaa
accttccgccgtatcatcaaagagaccggtgtggcgattatcggccagaccaactcactg
gcaccggcggacaagcgtttctatgcgacccgcgatattacggcaaccgtggattccatt
ccgctgatcaccgcctctatcctcggcaaaaaactggccgaaggactggatgcactggtg
atggatgtgaaagtcggttccggggcatttatgccgacctatgaattatcagagcagctg
gcgcaggcgatcgtacaggttgccaacggcgcgggctgccggaccactgcactgctgacc
gacatgaaccaggtgctggcatccagcgccggtaatgcggtggaagtgcgtgaagcggtg
cgtttcctgaccggtgagtaccgcaatccgcgcctgtatgaagtcactatggcgctgtgc
aaagagatgctggtttccggcgggctggcggctgaccgcacagaggcggaagcaaaatta
cagcaggtgctggataatggcaaagcggcggaaatcttcggccggatggttgccgcgcag
cgcggaccggctgattttatcgaacgctattcgcactatctgccatcggcagtgctcagt
aaaccggtctatgctgagacagaagggattgtgaccgccatggatacccgcgcactgggt
atggcggttgtttcgctgggcggcggacgccgtaaggccagcgacccgattgactacagt
gtcgggttaagtgatatcgcgccgatcaacagtgttgctgacggacagatgccgctggcg
atgatccacgccaataatgaagatgcgtggaatgaagcagctcaggccgtgcgccgggca
gtcacactcagtgagagcccggttacagataccccgctgatttaccgccggatcagcgaa
taa

DBGET integrated database retrieval system