KEGG   Mycoplasma mycoides subsp. capri LC 95010: MLC_0430Help
Entry
MLC_0430          CDS       T01478                                 

Gene name
recR
Definition
Recombination protein
Orthology
K06187  
recombination protein RecR
Organism
mml  Mycoplasma mycoides subsp. capri LC 95010
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mml00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    MLC_0430 (recR)
DNA repair and recombination proteins [BR:mml03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      MLC_0430 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(59382..59981)
Genome map
AA seq 199 aa AA seqDB search
MIKMLETTFDEIIESIRTNQGLTKKTSERLLVDLLINKDKLDQFIDQLNKAKQLISTCKI
CGYLSENNKCLVCSLDNRNQNTICIVSTILDAKNIENTNKYKGVYHILNGEINLNKNITF
DKLNISSIFKRINDNTEIILALNSTFEGELTANYLYKLLSTKNIKITRLAKGIPMGASLD
YMDEFTLQSAFLNRKKYGE
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
gtgattaaaatgttagaaactacatttgatgaaattattgaatcaattagaacaaatcaa
ggtttaactaaaaaaacatcagaaagattattagttgatttattaataaataaagataaa
ctagatcaatttattgatcaattaaataaagcaaaacaattaatttcaacttgcaaaata
tgtgggtatttaagtgaaaataataaatgtttagtatgtagtttagataatagaaatcaa
aatacaatttgtatagtttcaacaattttagatgcaaaaaacattgaaaatactaataaa
tacaaaggggtttatcatattttaaatggtgaaattaatctaaataaaaacattacattt
gataaattaaatattagttctatttttaaaaggattaatgataatactgaaattatttta
gctttaaattctacttttgaaggtgagttaactgctaattatttatacaaattactaagt
actaaaaacattaaaattacaagattagctaaaggaataccaatgggagctagtttagat
tatatggatgaattcactttacaaagtgcatttcttaatagaaaaaaatatggagaataa

DBGET integrated database retrieval system