KEGG   Mycoplasma mycoides subsp. capri LC 95010: MLC_1320Help
Entry
MLC_1320          CDS       T01478                                 

Gene name
tdk
Definition
thymidine kinase
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
mml  Mycoplasma mycoides subsp. capri LC 95010
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mml00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    MLC_1320 (tdk)
Enzymes [BR:mml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     MLC_1320 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
172403..173032
Genome map
AA seq 209 aa AA seqDB search
MTELDINEIEAYNSNKMGWIELITGCMFAGKTEEFIRRLRVLSYAKKRVLAFKPSIDNRY
SVENIISHSGSKLDSYLVHSSDEIKLIIEKENQIQQVDVIGIDEVQFFDEQVVELIEQLA
NQGIIVIVNGLDKDFRCLPFKNVDKLLVTAEFVTKLRARCHLCGNFANRSQRIVNGQPAL
WDSPLILVDGKESYEARCRNCFIAPKKEV
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgacagaattagatattaatgaaatagaagcatataattctaataaaatgggttgaatt
gaactaattacaggttgtatgtttgctggaaaaactgaagaatttataagacgtttaaga
gttttaagttatgctaaaaaaagagtattagcttttaaaccaagtattgataatagatat
tcagttgaaaatataatttcacattcaggaagtaaactagattcttatttagtacattca
agtgatgaaattaaactaattattgaaaaagaaaatcaaattcaacaagttgatgtaata
ggaattgatgaagtacaattttttgatgaacaagttgttgagttaattgaacaactagca
aatcaaggaattattgtaatagttaatggattagataaagactttagatgcttaccattt
aaaaacgttgataagttattagtaacagcagaatttgtaactaaactaagagctagatgt
catttatgtggaaattttgcaaatagatctcaaagaattgttaatggtcaacctgcttta
tgagattctcctttaattttagttgatggaaaagaaagttatgaagcaagatgtagaaac
tgttttatagctcctaaaaaggaagtgtaa

DBGET integrated database retrieval system