KEGG   Mycoplasma mycoides subsp. capri LC 95010: MLC_2780Help
Entry
MLC_2780          CDS       T01478                                 

Gene name
pfk
Definition
6 phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mml  Mycoplasma mycoides subsp. capri LC 95010
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mml00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MLC_2780 (pfk)
   01230 Biosynthesis of amino acids
    MLC_2780 (pfk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MLC_2780 (pfk)
   00030 Pentose phosphate pathway
    MLC_2780 (pfk)
   00051 Fructose and mannose metabolism
    MLC_2780 (pfk)
   00052 Galactose metabolism
    MLC_2780 (pfk)
  Energy metabolism
   00680 Methane metabolism
    MLC_2780 (pfk)
Enzymes [BR:mml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     MLC_2780 (pfk)
Protein phosphatases and associated proteins [BR:mml01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     MLC_2780 (pfk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(368673..369653)
Genome map
AA seq 326 aa AA seqDB search
MIKKIGILTSGGDAPGMNNAIAGVVKTAASKGIEVYGINDGYKGLVNGWFEKLNVEKTLD
ILSRGGTYLGSARLPEFKELEVRQKAVANLKKAGIEALVVIGGDGSYMGAQKLTEMGINC
IGLPGTIDNDISSTDYTIGFHTALNTIVEAVDRIRDTMQSHNRADVVEIMGNGCGDLVTY
TAVATGAEIFSPAEDLLTIEQMGQKAKQFRLLGKKSLIILVSEKSYGISAEEIAEKIQKI
SGYETKATVLGHIQRGGRPTAMDRYIAFTAGMFAVEKLAEGKGGLFIGLENNKLVARDID
STLNMKKEDKKPFINYLREINGYFSK
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgataaaaaaaattggaattttgacttctggaggggatgctcctggaatgaataatgcc
attgctggagttgtaaaaacagcagcttcaaagggaattgaagtatatgggattaatgat
ggatataaagggctagtaaatggttgatttgaaaaattaaatgttgaaaaaactttagat
attctttctagaggtggaacttatttaggttcagcaagactaccagagtttaaagaatta
gaagtaagacaaaaagctgttgctaatttaaaaaaagctggaattgaagctttagttgta
attggtggagatggtagttatatgggagctcaaaaattaactgaaatgggtattaattgt
attggattacctggaactattgataatgatatttcttcaactgattatactattggattt
catactgcattaaatacaattgttgaagcagttgatagaattagagatacaatgcaatca
cataatagagctgatgttgttgaaattatgggaaatggttgtggtgatttagtaacttat
acagcagttgctacaggagctgagatattttcaccagctgaagatctattaacaattgag
caaatgggtcaaaaagcaaaacaatttagattattaggtaaaaaaagtttaattatttta
gtttcagaaaaatcatatggaatttctgctgaagaaattgctgaaaaaattcaaaaaatt
agtggttatgaaactaaagcaactgttttaggacatattcaacgtggtggtagaccaact
gctatggatagatatattgcttttacagctggtatgtttgctgttgaaaaactagctgaa
ggtaaaggtggattatttataggattagaaaataataaactagttgcaagagatattgat
tcaactttaaatatgaaaaaagaagataaaaaaccttttatcaattatttaagagaaatt
aatggatattttagtaaataa

DBGET integrated database retrieval system