KEGG   Mycoplasma mycoides subsp. capri LC 95010: MLC_4920Help
Entry
MLC_4920          CDS       T01478                                 

Gene name
recD
Definition
exodeoxyribonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
mml  Mycoplasma mycoides subsp. capri LC 95010
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mml00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    MLC_4920 (recD)
Enzymes [BR:mml01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     MLC_4920 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
625610..627793
Genome map
AA seq 727 aa AA seqDB search
MEEQIKIRGYLSKFLYKSDSWALAIFTSENNPNKTIKIKGEISDLKPKILYELIGKQTSH
IKYGTSFEVSSFTLASINTEQQIINFLKSDVFPGIGNLTASKIAKLYSKNFIQEILNNKE
QFFQIKDISKDKLELIYNKIKQINQQNFLRIEFINHNLNLKILDKLKKFTDDENEIKQIL
TNNWFEFSFKHELGLMQDIDKIFLHFNNNDINNLTRISYWHLYACNEILFNLGDSYTYKN
YLFKKVSDLIKINDLDLLNNALDYAIKNELLVLKNEKIYTYESFNDELIISEVLVNNHLK
TNDIDDDLLTSYINQIQLNTQIKDFKYDKDQVLALKNFIKHKISIITGGPGTGKTTIIKA
IVELFKKVYHSSNYAICTPTGRAAAKIRENFTESHATTIHKLLGYEKDNKFSVNKYHPLD
YDLLILDECSMIDARLFSQFLSSINNAKKIVLIGDVDQLASVGYGNVFYDIINSKIICTT
NLINIHRQSFNNGIIDLAYMIKNDNLDLNKLQNLDNVEFFFNKDKQACLEYLKTVYSKTI
NQTKNIQVISPVYADILGIENLNNFIQYNFNQNILDTNNVYDRLRFRYAVNDKVMYLKND
SELNLSNGDIGYICQINKNNNKFNSAIINFNNNLFEFTSEQFDEINLSYCCSVHKTQGSE
YDQVILVLQDTLFSSFLNKKLLYTAITRAKKQLVVIGDFDLFIKASKKNARIRKTTLIEH
ILDKLNN
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atggaagaacaaataaaaatcagaggttatttatctaagtttttatacaaatcagattct
tgagctttagctatttttacaagtgaaaataatcctaataaaactataaaaattaaaggt
gaaattagtgatttaaaaccaaaaattttatatgaattaataggaaaacaaacaagtcat
attaaatatggaacaagttttgaagtaagtagttttactttagcaagtattaatacagaa
caacaaattattaactttttaaaatctgatgtttttccaggaattggtaatttaacagct
agtaaaatagctaaactttattcaaaaaactttatacaagaaattttaaataataaagaa
cagttttttcaaatcaaagatattagtaaagataaattagaattaatttataataaaatc
aaacaaattaatcaacaaaactttttaagaattgaatttattaatcataatttgaactta
aaaatattagataaactaaaaaagtttactgatgatgaaaatgaaataaaacaaattcta
actaataattggtttgaatttagttttaaacatgaacttggtttaatgcaagatattgat
aaaatatttttacattttaacaataatgatattaataatttaactagaattagttattga
catttgtatgcttgtaatgagattttatttaatttaggagatagttatacttataaaaac
tacttatttaaaaaagtttctgatttaataaaaattaatgatttagatttattaaataac
gctttagattatgctattaaaaatgaattattagttttaaaaaatgaaaagatttatact
tatgaatcatttaatgatgaattaataattagtgaagttttagttaataatcatttaaaa
actaatgatattgatgatgatttattaactagttatattaatcaaattcaactaaataca
caaattaaagattttaaatatgacaaagatcaagttttagctttaaaaaactttattaag
cataaaatcagtattataactggaggacctggaactggtaaaacaacaattattaaagca
atagttgaattgtttaaaaaagtttatcattctagtaattatgcaatttgtacaccaact
ggaagagcagctgcaaaaattagagaaaactttacagaaagtcatgcaacaactattcat
aaacttttaggttatgaaaaagacaataaatttagtgttaataaatatcatccactagat
tatgatttattaatacttgatgaatgttcaatgatcgatgctcgtttattttctcagttt
ttatcttcaataaataatgctaaaaaaattgttttgattggtgatgttgatcagttagca
agtgttgggtatggaaatgttttttatgatattattaattccaaaattatttgtactact
aatttaataaacattcatcgtcaaagttttaataatggaattattgatctagcttatatg
ataaaaaatgataatttagatctaaacaaattacaaaacttagataatgtagagtttttc
tttaataaagataaacaagcttgtttagagtatttaaaaacagtttatagtaaaactatt
aatcaaacaaaaaatattcaagtgatttctccagtttatgctgatattttaggaattgaa
aatttaaataattttattcaatataactttaatcaaaatattttagatactaataatgtt
tatgataggttaagatttagatatgctgttaatgataaagttatgtatttaaaaaatgat
agtgaattaaatttatcaaatggtgatattggatatatttgtcaaattaataaaaataat
aataaatttaattcagctattattaactttaataacaacttgtttgaatttacaagtgaa
caatttgatgaaattaatttaagttattgttgtagtgtacataaaactcaaggtagtgaa
tatgatcaagtaattttagttttacaagatactttatttagtagttttttaaataaaaaa
cttttatatacagctattactagagcaaaaaaacaactagtagtaattggtgattttgac
ttgtttataaaagcaagtaaaaaaaatgcaagaattagaaaaactactttaattgaacat
attttagataaattaaataattag

DBGET integrated database retrieval system