KEGG   Mycoplasma mycoides subsp. capri LC 95010: MLC_7440Help
Entry
MLC_7440          CDS       T01478                                 

Gene name
tpi
Definition
Triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mml  Mycoplasma mycoides subsp. capri LC 95010
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:mml01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:mml01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mml00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:mml00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
930113..930859
Genome map
AA seq 248 aa AA seqDB search
MKKKVIFGNWKMNGTNESLTDFLNQVDNKIDSSKIIAGLAVPYVMLQTGLKLAKNVKIAA
QNVHYKDKGAYTGEISTTMLKEIGVEYVIIGHSERREMFNETDLDVNKKAKVLLENNITP
IICCGETLQTKESGKTIEFVNNQINIMFEGIKKEEAIKAIIAYEPIWAIGTGKTATSSDA
EEVCKQIRNNLTKIYDKDTAEQIIIQYGGSVKPSNIQEYLKMPNIDGALVGGASLLANDY
LGLVNYNE
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaaaggtaatttttggtaattgaaaaatgaatgggactaatgaaagtttgaca
gattttttaaaccaagtagataataaaatagatagttcaaaaattatagcaggattagct
gtaccttatgtaatgttacaaactgggctaaaacttgcaaaaaatgttaaaatagctgct
caaaacgtacattataaagataagggtgcttatactggagaaatttcaactacaatgcta
aaagaaatcggagttgaatatgtaattattggacattctgaaagaagagaaatgtttaat
gaaactgatttagatgttaataaaaaagctaaagttttattagaaaataatataactcct
attatttgttgtggtgaaactttacaaactaaagaaagtggaaaaactattgaatttgta
aataatcaaattaatataatgtttgaaggtattaaaaaagaagaagcaatcaaagcaatt
attgcttatgaaccaatttgagcaattggtactggaaaaacagcaacaagtagcgatgct
gaagaagtatgtaaacaaatcagaaataatttaacaaaaatttatgataaagatacagct
gaacaaattattattcagtatggtggaagtgttaaaccatcaaatattcaagaatattta
aaaatgccaaatattgatggagctttagttggaggagcttctttattagctaatgattat
ttaggtttagttaactataatgaataa

DBGET integrated database retrieval system