KEGG   Mycoplasma mycoides subsp. capri LC 95010: MLC_7910Help
Entry
MLC_7910          CDS       T01478                                 

Gene name
glk
Definition
(GenBank) Glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
mml  Mycoplasma mycoides subsp. capri LC 95010
Pathway
mml00010  Glycolysis / Gluconeogenesis
mml00052  Galactose metabolism
mml00500  Starch and sucrose metabolism
mml00520  Amino sugar and nucleotide sugar metabolism
mml00521  Streptomycin biosynthesis
mml01100  Metabolic pathways
mml01110  Biosynthesis of secondary metabolites
mml01120  Microbial metabolism in diverse environments
mml01130  Biosynthesis of antibiotics
mml01200  Carbon metabolism
Module
mml_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mml_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mml00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MLC_7910 (glk)
   00052 Galactose metabolism
    MLC_7910 (glk)
   00500 Starch and sucrose metabolism
    MLC_7910 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    MLC_7910 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    MLC_7910 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    MLC_7910 (glk)
Enzymes [BR:mml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     MLC_7910 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK FGGY_N BcrAD_BadFG Glucokinase Spermine_synth Hydantoinase_A
Motif
Other DBs
NCBI-ProteinID: CBW54521
UniProt: F4MQY8
Position
983780..984745
Genome map
AA seq 321 aa AA seqDB search
MKKILGIDLGGTSAKVGVISQNGDLEHSFSITNPKTKIIENLYFEISKILKTLNVDENDI
MLVGITAPGFVDHNKGIVVMAPNIENGWFNYDLKTEAEFLFKKPVYVINDVNAAALGEYR
KGSGLVYKSGLFYWLGTGIGGAIICDGKLISGSHGFAGEFGHGGSNNHNLKCNCGLNNCI
EKVCSATTIPNSLLTILKNKYLEFYNKHFLNIKDLDMKLLFEIYNNLNKPIELKNSLLEV
YDELFNHMSLLIHALDPEVVVIGGGGSLAGNNLLELFQLGVKNKLTDSYKDIVDFKLALL
KNDAGMIGAAFYALEQSLKTN
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatattaggaatagatcttggtgggacttcagcaaaagttggagtaatttca
caaaatggagatttagagcatagtttttctataactaatccaaaaactaaaattatagaa
aacttatattttgaaatttcaaaaattttaaaaactttaaatgttgatgaaaatgacatt
atgttagttggaattacagctcctgggtttgttgatcataataaaggaattgtagttatg
gctccaaatattgaaaatggatgatttaattatgatttaaaaactgaagctgaatttcta
tttaaaaaacctgtttatgttattaatgatgttaatgctgctgcacttggtgaatataga
aaaggttcagggttagtttataaatcaggattattttattgattaggaacaggaattggt
ggagcaattatttgtgatggaaaactaatttctggatcacatggatttgctggagaattt
ggacatggtggaagtaataatcacaatttaaaatgtaattgtggtttaaataattgtatt
gaaaaagtatgttcagcaacaactataccaaattcacttttaacaattttaaaaaataaa
tatttagaattttataataagcattttttaaatattaaagatttagatatgaaactttta
tttgaaatctataataatttaaacaagccaatagaattaaaaaatagtttattagaagtt
tatgatgaattgtttaatcatatgtcattactaatacatgctttagatcctgaagttgtt
gttattggtggtggtggttcattagctggaaataatttgttagaattatttcaattagga
gttaaaaataaattaacagattcttataaagatatagttgattttaaactagctttatta
aaaaatgatgctggtatgattggtgctgctttttatgcactagaacaatcactaaaaaca
aattaa

DBGET integrated database retrieval system