KEGG   Mycoplasma mycoides subsp. capri LC 95010: MLC_7910Help
Entry
MLC_7910          CDS       T01478                                 

Gene name
glk
Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
mml  Mycoplasma mycoides subsp. capri LC 95010
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Overview; Carbon metabolism [PATH:mml01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mml00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:mml00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:mml00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:mml00520]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:mml00521]
Metabolism; Biosynthesis of other secondary metabolites; Butirosin and neomycin biosynthesis
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
983780..984745
Genome map
AA seq 321 aa AA seqDB search
MKKILGIDLGGTSAKVGVISQNGDLEHSFSITNPKTKIIENLYFEISKILKTLNVDENDI
MLVGITAPGFVDHNKGIVVMAPNIENGWFNYDLKTEAEFLFKKPVYVINDVNAAALGEYR
KGSGLVYKSGLFYWLGTGIGGAIICDGKLISGSHGFAGEFGHGGSNNHNLKCNCGLNNCI
EKVCSATTIPNSLLTILKNKYLEFYNKHFLNIKDLDMKLLFEIYNNLNKPIELKNSLLEV
YDELFNHMSLLIHALDPEVVVIGGGGSLAGNNLLELFQLGVKNKLTDSYKDIVDFKLALL
KNDAGMIGAAFYALEQSLKTN
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatattaggaatagatcttggtgggacttcagcaaaagttggagtaatttca
caaaatggagatttagagcatagtttttctataactaatccaaaaactaaaattatagaa
aacttatattttgaaatttcaaaaattttaaaaactttaaatgttgatgaaaatgacatt
atgttagttggaattacagctcctgggtttgttgatcataataaaggaattgtagttatg
gctccaaatattgaaaatggatgatttaattatgatttaaaaactgaagctgaatttcta
tttaaaaaacctgtttatgttattaatgatgttaatgctgctgcacttggtgaatataga
aaaggttcagggttagtttataaatcaggattattttattgattaggaacaggaattggt
ggagcaattatttgtgatggaaaactaatttctggatcacatggatttgctggagaattt
ggacatggtggaagtaataatcacaatttaaaatgtaattgtggtttaaataattgtatt
gaaaaagtatgttcagcaacaactataccaaattcacttttaacaattttaaaaaataaa
tatttagaattttataataagcattttttaaatattaaagatttagatatgaaactttta
tttgaaatctataataatttaaacaagccaatagaattaaaaaatagtttattagaagtt
tatgatgaattgtttaatcatatgtcattactaatacatgctttagatcctgaagttgtt
gttattggtggtggtggttcattagctggaaataatttgttagaattatttcaattagga
gttaaaaataaattaacagattcttataaagatatagttgattttaaactagctttatta
aaaaatgatgctggtatgattggtgctgctttttatgcactagaacaatcactaaaaaca
aattaa

DBGET integrated database retrieval system