KEGG   Mycobacterium sp. MOTT36Y: W7S_01490Help
Entry
W7S_01490         CDS       T02113                                 

Definition
hypothetical protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
mmm  Mycobacterium sp. MOTT36Y
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:mmm00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    W7S_01490
Enzymes [BR:mmm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     W7S_01490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(309841..310719)
Genome map
AA seq 292 aa AA seqDB search
MGVVVIGQIARDLVLRTDGPPTTDDSTTVVQRKELLGGKGANQAVGLAQLGVPVALIAVA
GDDDAGTSVLAQAQRDGIDVGGVARRGTTALLIDVVPKPPERMLLEDVPESSLIQVADLD
RSVFDTADTVSIQLQQPPATALEAAQRARRRGLRVVADGAPAEHIRADLLAAVDVIRADA
TEASLIAGREIGTAAQARELADRLLACGPGLVALAVPKVGDLVAWDGGSRLFEFADVDVV
DPTGAGDAFVAGLIAALRDGAAPPEAGELAAAAASATVQRLGGRPDLTALKA
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgggcgttgtcgtgatcggccagatcgcacgcgatctggtgctgcgtaccgatgggccg
ccgacgaccgacgattccaccacggtcgtgcagcgcaaggagctgctgggcggcaagggc
gccaatcaggcggtcggcctggcgcagctgggcgtgccggtcgccctcatcgcggtggcc
ggtgacgacgacgcggggacgtcggtcctggcgcaggcccaacgggacggcatcgacgtc
ggcggcgtcgcgcgtcgcggcaccacggcgctgttgatcgatgtggtcccaaaaccgccg
gaacgcatgctcctcgaagacgtgcccgaaagctcgctgatccaagtcgccgacctcgat
cggtccgtgttcgacaccgccgacaccgtttccattcagctgcagcagccgccggccacc
gcgttggaagccgcgcaacgcgctcggcggcggggtctgcgcgtcgtggccgacggcgcg
cccgccgagcacattcgggccgacctgctcgcggcggtcgacgtgatccgcgccgacgcc
acggaagcctcgctcatcgcgggccgggagatcggcacggcggcgcaggcgcgcgagctg
gccgaccgcctgttggcctgcggtccgggactggtcgccctcgcggttccgaaggtcggt
gacctggtggcgtgggacggtggcagccggctcttcgaattcgccgacgtcgacgtggtg
gatccgaccggcgcgggcgacgcgttcgtggccgggctgatcgccgcgctgcgtgatggc
gccgcaccaccggaggccggcgagcttgcggccgcggccgccagcgccaccgttcagcgc
ctcggcggccggcccgacctgaccgcgctcaaggcgtga

DBGET integrated database retrieval system