KEGG   Mycobacterium sp. MOTT36Y: W7S_01670Help
Entry
W7S_01670         CDS       T02113                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
mmm  Mycobacterium sp. MOTT36Y
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:mmm03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
345828..346439
Genome map
AA seq 203 aa AA seqDB search
MFEGPVQDLIDELGKLPGIGPKSAQRIAFHLLSVEPPDIDRLTAVLAKVRDGVRFCAVCG
NVSDNERCRICADPRRDGSQVCVVEEPKDVQAVERTREFRGRYHVLGGALDPLSGVGPDQ
LRIRELLSRIGERVDDVDITEVIIATDPNTEGEATATYLVRMLRDIPGLTVTRIASGLPM
GGDLEFADELTLGRALAGRRAMV
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgttcgaaggacccgtccaggatttgatcgacgagctgggcaagctgcccggcatcggg
cccaagagcgcccagcgcatcgccttccacctgctgtcggttgagccgccggacatcgac
cggctgaccgcggtgctggccaaggtgcgcgacggcgtgcggttctgtgcggtgtgcggc
aacgtctccgacaacgaacggtgccggatctgcgccgatccgcggcgggacgggtcgcag
gtttgcgtcgtcgaggaaccgaaggacgtgcaggccgtcgagcgcacccgcgaattccgc
ggccgctatcacgtgctgggcggggcgctcgatccgctgtccggggtggggcccgaccag
ctgcggatccgcgagctgctgagccggatcggggagcgggtcgacgacgtcgacatcacc
gaggtgatcatcgccaccgacccgaacaccgagggcgaggcgacggccacctacctggtg
cggatgctgcgtgacatccccggcctgaccgtgacgcggatcgcctccgggctgccgatg
ggcggtgacctggagttcgccgacgagctgacgctcggccgcgcgctggccggccgccgg
gccatggtctga

DBGET integrated database retrieval system