KEGG   Mycobacterium sp. MOTT36Y: W7S_02235Help
Entry
W7S_02235         CDS       T02113                                 

Definition
(GenBank) dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
mmm  Mycobacterium sp. MOTT36Y
Pathway
mmm00790  Folate biosynthesis
mmm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    W7S_02235
Enzymes [BR:mmm01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     W7S_02235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind DUF5132
Motif
Other DBs
NCBI-ProteinID: AFJ33430
UniProt: I2A806
Position
455660..456487
Genome map
AA seq 275 aa AA seqDB search
MGVLNVTDDSFSDGGRYLDPDKAVAHGLALAADGADIVDVGGESTRPGATRVDARVEASR
VVPVVKELSSQGITVSIDTMHADVARAALCSGARIVNDVSGGRADPAMAPLLAEAKVPWV
LMHWRSVSAQRPHAAPDYRDVVAEVRAELLASVDAAVSAGVDPAQLMIDPGLGFAKTGQH
NWALLHALPRLVATGIPVLLGASRKRFLGTLLAGPDGSPRPPDGRETATAVISALAALHG
AWGVRVHDVRATVDALKVVAAWNDETHTGLAEHDG
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgggagttctgaacgtcactgacgattcgttctccgacggcggccgctatctcgacccc
gacaaagccgtggcacacggattggcgctggccgccgacggcgccgacatcgtcgacgtc
gggggagaatccacccgtcccggtgccacgcgcgtcgacgcccgtgtcgaggcctcccgg
gtcgtccccgtggtcaaagagctttcctcgcaaggcattacggtgagcatcgataccatg
cacgccgacgtcgcgcgggcggcgctgtgcagcggcgcgcggatcgtcaacgacgtgtcc
ggcggccgggccgatcccgccatggcgccgctgctggccgaggcgaaagtgccttgggtg
ctgatgcattggcgctccgtgtcggcgcagcgtccgcacgcggccccggactatcgtgac
gtggtcgccgaggtgcgcgccgagttgcttgccagtgtcgacgccgcggtgtccgccggt
gtcgatcccgctcagctgatgatcgatccggggctgggattcgccaagacgggacaacac
aattgggcgctgctgcatgcgctgccgcgattggtcgccaccgggatcccggtgctgctg
ggcgcgtcgcgcaaacggttcctcggtacgttgctggccgggcccgacggttcgccgcgg
ccccccgacgggcgtgagacggcgaccgcggtgatttccgcgctcgccgcgctgcacggg
gcctggggggtacgggtgcacgatgtgcgcgccacggtcgatgcgctcaaggtcgtggcg
gcgtggaacgacgagacgcacactgggctggctgaacacgatggctga

DBGET integrated database retrieval system