KEGG   Mycobacterium sp. MOTT36Y: W7S_02245Help
Entry
W7S_02245         CDS       T02113                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
mmm  Mycobacterium sp. MOTT36Y
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    W7S_02245
Enzymes [BR:mmm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     W7S_02245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
456934..457452
Genome map
AA seq 172 aa AA seqDB search
MTRVVLSIGSNLGDRLARLQSVVDGLGDAVLAVSPVYETDPWGRVDQAPFLNAVLIADDP
ACDGQGWLARAQEFERAAGRVRGERWGPRTLDVDLIACYGQAEVTSRENNLTLPHPLAHL
RAFVLIPWLAVDPDARLTVAEGPRPVAQLLAELEPADRAAVRRSDLTLELTT
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgaccagagtggtgttgtccatcgggtccaacctgggggaccggctggcgcggttgcag
tcggtcgtcgacgggctgggggacgcggtgctcgccgtgtcaccggtgtacgagaccgac
ccctggggccgggtcgatcaggcgccgttcctgaacgcggtgctgatcgccgacgacccg
gcctgcgacgggcagggctggctggcccgggcgcaggagttcgagcgcgcggcgggcagg
gtccgcggcgagcgctgggggccgcgcaccctcgacgtcgacctgatcgcctgttacggg
caagctgaggtgacctcgcgggagaacaacctgacgctcccgcatccgctggcccatttg
cgggccttcgtgctgatcccctggctggcggtcgacccggacgctcggctgacggtcgcc
gaagggccgcgtcccgtcgcgcagttgctggccgaactggagcccgccgaccgtgccgcc
gtacggcgctccgacctgacgctcgagctcacaacctga

DBGET integrated database retrieval system