KEGG   Mycobacterium sp. MOTT36Y: W7S_02625Help
Entry
W7S_02625         CDS       T02113                                 

Definition
acetaldehyde dehydrogenase (EC:1.2.1.10)
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
mmm  Mycobacterium sp. MOTT36Y
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Module
Trans-cinnamate degradation, trans-cinnamate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mmm00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    W7S_02625
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    W7S_02625
   00650 Butanoate metabolism
    W7S_02625
  Amino acid metabolism
   00360 Phenylalanine metabolism
    W7S_02625
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    W7S_02625
   00622 Xylene degradation
    W7S_02625
   00621 Dioxin degradation
    W7S_02625
Enzymes [BR:mmm01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     W7S_02625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
530053..530985
Genome map
AA seq 310 aa AA seqDB search
MPSKASVAIVGSGNISTDLLYKLLRSDWLEPRWMVGIDPESEGLARARKLGLETTHEGVD
WLLAQSDKPDLVFEATSAYVHRDAAPKYEAAGIRAVDLTPAAVGPAVIPPANLRQHLDAP
NVNMITCGGQATIPIVYAVSRAVADLGGVPYAEIVASVASLSAGPGTRANIDEFTKTTSK
GVETIGGAKRGKAIIILNPADPPMIMRDTIFCAIPEDADRDAIAKSIHDVVAEVQTYVPG
YRLLNDPQFDDPSINSGGQALVTTFVEVEGAGDYLPPYAGNLDIMTAAATKVGEEIAKES
LTATAGGAQS
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgccgtctaaggcgagtgtggccatcgtcgggtcgggcaacatcagcactgacctgctt
tacaagttgttgcgatcggactggctggagccgcgctggatggtcggcatcgaccccgaa
agcgagggcctggcgcgggcccgcaagctgggtttggagaccacccacgagggcgtggac
tggttgctggcgcagtcggacaagcccgatctggtgttcgaggcgaccagcgcctatgtg
catcgcgacgccgcgcccaagtacgaggccgccggcatccgggccgtcgacctgacgccc
gccgcggtgggtcccgcggtgatcccgccggccaacctgcgccagcacctggatgcgccc
aacgtcaacatgatcacctgcggcgggcaggccaccatcccgatcgtgtatgcggtgtcg
cgcgccgtcgccgacctcggtggggtgccgtacgccgagatcgtcgcctcggtcgcctcg
ctgtcggcggggccgggaacccgggccaacatcgacgagttcaccaagaccaccagcaag
ggcgtggagaccatcggtggcgccaagcggggcaaggcgatcatcatcttgaaccccgcc
gatccgccgatgatcatgcgcgacaccatcttttgcgccattcccgaggacgccgaccgc
gacgcgatcgccaagtccatccacgacgtggtggccgaggtgcagacctacgttcccggc
taccggctgctcaacgacccgcagttcgacgacccgtcgatcaactccggcggccaggcg
ctggtcaccacgttcgtcgaagtcgagggggccggcgattacctgcccccctatgcgggc
aacctggacatcatgaccgccgcggctaccaaggtcggcgaggagatcgccaaggaatcc
ttgaccgcgacggccggaggagcgcaatcatga

DBGET integrated database retrieval system