KEGG   Mycobacterium sp. MOTT36Y: W7S_04665Help
Entry
W7S_04665         CDS       T02113                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
mmm  Mycobacterium sp. MOTT36Y
Pathway
mmm00020  Citrate cycle (TCA cycle)
mmm00640  Propanoate metabolism
mmm00660  C5-Branched dibasic acid metabolism
mmm01100  Metabolic pathways
mmm01110  Biosynthesis of secondary metabolites
mmm01120  Microbial metabolism in diverse environments
mmm01130  Biosynthesis of antibiotics
mmm01200  Carbon metabolism
Module
mmm_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mmm_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mmm00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    W7S_04665 (sucC)
   00640 Propanoate metabolism
    W7S_04665 (sucC)
   00660 C5-Branched dibasic acid metabolism
    W7S_04665 (sucC)
Enzymes [BR:mmm01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     W7S_04665 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 CPSase_L_D2 GARS_A
Motif
Other DBs
NCBI-ProteinID: AFJ33916
UniProt: I2A9E2
Position
932802..933965
Genome map
AA seq 387 aa AA seqDB search
MDLFEYQAKELFAKHNVPTTPGRVTDTAEGAREIATEIGRPVMVKAQVKVGGRGKAGGVK
YAATPDDAYEHAKNILGLDIKGHVVKKLLVAEASDIAEEYYISFLLDRANRTYLAMCSVE
GGMEIEEVAATKPERLAKVPVDAVKGVDLATARSIAEQGHLPAEVLDAAAVTINKLWEVF
VAEDATLVEVNPLVRDPKDQILALDGKVTLDANADFRQPGHAEFEDRDATDPLELKAKEH
DLNYVKLDGSVGIIGNGAGLVMSTLDVVAYAGEKHGGVKPANFLDIGGGASAEVMAAGLD
VILNDKQVKSVFVNVFGGITSCDAVANGIVTALNMLGDEANKPLVVRLDGNNVDEGRRIL
AQANHPLVIQAETMDAGADKAAELAHK
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atggaccttttcgagtatcaagcaaaagaattgttcgccaagcacaacgtaccgactacg
ccgggacgcgtgaccgacaccgccgagggcgcccgcgagatcgccaccgagatcggccgt
ccggtgatggtcaaggcgcaggtgaaggtcggcgggcgcggcaaggccggcggcgtcaag
tacgcggcgacgcccgacgacgcctacgagcacgcgaagaacatcctcggtctcgacatc
aagggacacgtcgtcaagaagctgctggtcgccgaggccagcgacatcgccgaggagtac
tacatctccttcctgctcgaccgcgccaaccgcacctacctggccatgtgctcggtcgag
ggcggcatggaaatcgaggaggtcgccgcgaccaagcccgagcggctggccaaggttccg
gtggacgccgtcaagggcgtcgacctggcgaccgcgcgctccatcgccgagcagggccac
ctgcccgccgaggtgctggacgccgccgccgtcaccatcaacaagctgtgggaggtcttc
gtcgccgaggacgccaccctggtcgaggtcaacccgctggtgcgcgaccccaaagaccag
atcctggcgctggacggcaaggtcaccctcgacgccaacgccgacttccgtcagcccggc
cacgccgagttcgaggaccgcgacgccacggacccgctggagctcaaggccaaggagcac
gacctcaactacgtcaagctggacggctcggtcggcatcatcggaaacggcgcgggcctg
gtgatgtccacgctggacgtcgtcgcctacgcgggcgagaagcacggcggggtcaagccg
gccaacttcctggacatcggtggtggcgcgtcggcagaggtgatggccgccggcctggac
gtcatcctgaacgacaagcaggtcaagagcgtcttcgtgaacgtgttcggtggcatcacc
tcctgcgacgccgttgccaacgggatcgtgaccgcgctgaatatgctcggcgacgaggcg
aacaagccgctcgtggtccggctcgacggcaacaacgtcgacgaaggccggcgcatcctg
gcccaagccaaccacccgctggtgatccaggccgagaccatggacgccggtgccgacaaa
gccgccgagctggcgcacaagtaa

DBGET integrated database retrieval system