KEGG   Mycobacterium sp. MOTT36Y: W7S_04665Help
Entry
W7S_04665         CDS       T02113                                 

Gene name
sucC
Definition
succinyl-CoA synthetase subunit beta (EC:6.2.1.5)
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
mmm  Mycobacterium sp. MOTT36Y
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:mmm01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:mmm00020]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:mmm00640]
Metabolism; Carbohydrate metabolism; C5-Branched dibasic acid metabolism [PATH:mmm00660]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
932802..933965
Genome map
AA seq 387 aa AA seqDB search
MDLFEYQAKELFAKHNVPTTPGRVTDTAEGAREIATEIGRPVMVKAQVKVGGRGKAGGVK
YAATPDDAYEHAKNILGLDIKGHVVKKLLVAEASDIAEEYYISFLLDRANRTYLAMCSVE
GGMEIEEVAATKPERLAKVPVDAVKGVDLATARSIAEQGHLPAEVLDAAAVTINKLWEVF
VAEDATLVEVNPLVRDPKDQILALDGKVTLDANADFRQPGHAEFEDRDATDPLELKAKEH
DLNYVKLDGSVGIIGNGAGLVMSTLDVVAYAGEKHGGVKPANFLDIGGGASAEVMAAGLD
VILNDKQVKSVFVNVFGGITSCDAVANGIVTALNMLGDEANKPLVVRLDGNNVDEGRRIL
AQANHPLVIQAETMDAGADKAAELAHK
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atggaccttttcgagtatcaagcaaaagaattgttcgccaagcacaacgtaccgactacg
ccgggacgcgtgaccgacaccgccgagggcgcccgcgagatcgccaccgagatcggccgt
ccggtgatggtcaaggcgcaggtgaaggtcggcgggcgcggcaaggccggcggcgtcaag
tacgcggcgacgcccgacgacgcctacgagcacgcgaagaacatcctcggtctcgacatc
aagggacacgtcgtcaagaagctgctggtcgccgaggccagcgacatcgccgaggagtac
tacatctccttcctgctcgaccgcgccaaccgcacctacctggccatgtgctcggtcgag
ggcggcatggaaatcgaggaggtcgccgcgaccaagcccgagcggctggccaaggttccg
gtggacgccgtcaagggcgtcgacctggcgaccgcgcgctccatcgccgagcagggccac
ctgcccgccgaggtgctggacgccgccgccgtcaccatcaacaagctgtgggaggtcttc
gtcgccgaggacgccaccctggtcgaggtcaacccgctggtgcgcgaccccaaagaccag
atcctggcgctggacggcaaggtcaccctcgacgccaacgccgacttccgtcagcccggc
cacgccgagttcgaggaccgcgacgccacggacccgctggagctcaaggccaaggagcac
gacctcaactacgtcaagctggacggctcggtcggcatcatcggaaacggcgcgggcctg
gtgatgtccacgctggacgtcgtcgcctacgcgggcgagaagcacggcggggtcaagccg
gccaacttcctggacatcggtggtggcgcgtcggcagaggtgatggccgccggcctggac
gtcatcctgaacgacaagcaggtcaagagcgtcttcgtgaacgtgttcggtggcatcacc
tcctgcgacgccgttgccaacgggatcgtgaccgcgctgaatatgctcggcgacgaggcg
aacaagccgctcgtggtccggctcgacggcaacaacgtcgacgaaggccggcgcatcctg
gcccaagccaaccacccgctggtgatccaggccgagaccatggacgccggtgccgacaaa
gccgccgagctggcgcacaagtaa

DBGET integrated database retrieval system