KEGG   Mycobacterium sp. MOTT36Y: W7S_04805Help
Entry
W7S_04805         CDS       T02113                                 

Definition
hypothetical protein
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mmm  Mycobacterium sp. MOTT36Y
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mmm00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    W7S_04805
   00052 Galactose metabolism
    W7S_04805
   00500 Starch and sucrose metabolism
    W7S_04805
   00520 Amino sugar and nucleotide sugar metabolism
    W7S_04805
Enzymes [BR:mmm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     W7S_04805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
964266..965177
Genome map
AA seq 303 aa AA seqDB search
MSCPNVVVPRTAVVPAAGLGTRFLPATKTVPKELLPVVDTPGIELVAAEAAEAGAERLVI
ITSEGKDGVVAHFVEDLVLESTLEERGKTAMLDKVRRAPRLIKVESVVQSEPLGLGHAIG
CVESRLSDDEDAIAVLLPDDLVLPTGVLGTMSKVRAHHGGTVLCAIEVTPEEISAYGVFD
VEPVPDDENPDVLRVKSMVEKPKAEDAPSLFAAAGRYVLDRAIFDALRRTERGAGGEVQL
TDGIALLIAEGHPVHVVVHRGSRHDLGNPGGYLKAAVDFALDRDDYGPDLRQWLVARLGL
AEQ
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgtcatgcccaaacgtggtggtgccacgcacggctgttgtgcccgccgccggtctcggt
acccgcttcttgccggcaaccaaaacggttcccaaggaactgctaccggtggtcgatacc
ccgggcatagagctggtggccgccgaggcggccgaagccggtgccgagcggctggtgatc
atcacctccgagggcaaggacggcgtcgtcgcgcatttcgtcgaagacctcgtactggaa
agcacgctggaggagcgcggcaaaaccgcgatgctcgacaaggtccgccgcgcgccgcga
ctgatcaaggtcgagtccgtggtgcagagcgaaccgctggggctcggccacgcgatcggg
tgcgtggaatcgcggctgtccgacgacgaggacgcgatcgctgtgctgctgccggacgac
ctggtgttgccgaccggcgtgctgggcacgatgtcgaaggtgcgtgcccaccacggcggc
accgtgttgtgcgcgatcgaggtcacccccgaagagatcagcgcctacggcgttttcgac
gtcgagccggtgcccgacgatgagaaccccgacgtgctccgggtcaagagcatggtcgag
aagcccaaggccgaggacgcgccgtcgctgttcgccgcggcgggccgatatgtgctcgac
cgcgccatctttgacgcgttgcgccgcaccgagcgcggggccggtggcgaagtgcaactc
accgacggcatcgccctgctgatcgcggagggccacccggtgcatgtggtcgtgcaccgc
ggatctcgacacgacttgggaaatcctggcggctacctcaaggctgcggttgactttgca
ttggatcgtgacgactacggcccggatttgcggcaatggttggtggcgcgattgggcctg
gccgagcagtag

DBGET integrated database retrieval system