KEGG   Mycobacterium sp. MOTT36Y: W7S_06120Help
Entry
W7S_06120         CDS       T02113                                 

Definition
succinyl-diaminopimelate desuccinylase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
mmm  Mycobacterium sp. MOTT36Y
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:mmm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    W7S_06120
  Amino acid metabolism
   00300 Lysine biosynthesis
    W7S_06120
Enzymes [BR:mmm01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     W7S_06120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1258383..1259447
Genome map
AA seq 354 aa AA seqDB search
MLDLRGDPIALTAALVDIPSESRNEARLADEVEAALRAQTSGFEIVRNGNAVLARTRHQR
PSRVLLAGHLDTVPVAGNLPSRHEGGELHGCGTADMKSGDAVFLHLAATVAEPVHDLTLV
MYDCEEIDAAANGLGRIERELPDWLAADVAILGEPTGGYIEAGCQGTLRVVVSATGTRAH
SARSWLGDNAIHKLGAVLERLAAYQARSVDIDGCTYREGLSAVRIDGGVAGNVIPDAAAV
TVNFRFAPDRSAPDALQHVHDVLAGLDVHIEQTDAAAGAMPGLSQPAAKALVEAAGGNVR
AKYGWTDVARFAALGIPAVNFGPGDPNLAHRRDERVAVANITAAVDMLRRYLAG
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
gtgctggacttacgcggggatccgatcgcgctgaccgcggcgctggtcgacatccccagc
gaatcgaggaacgaggcgcgcctggccgacgaggtcgaggccgcgctgcgcgctcagacc
tccggcttcgagatcgtccgcaacggcaacgccgtgttggcgcgaacccgacaccagcgg
ccgtcgcgggtgctgctggccggccacctggacaccgtcccggtggccggaaacctgccc
agccgtcacgagggcggcgagctgcacggctgcggcaccgccgacatgaaatccggggac
gccgtgttcctccatctcgccgccaccgtcgccgaacccgtgcacgatctgacgctggtg
atgtacgactgcgaggaaatcgatgcggcggcaaacggtttgggccgcatcgaacgcgaa
ctgccggactggctggccgcggacgtggccatcctgggcgaaccgacgggcggctacatc
gaagccggttgccagggcaccctgcgcgtggtcgtcagcgccaccgggacccgcgcccac
tcggcgcgatcctggttgggggacaacgccattcacaaactgggtgccgtgctcgaacgg
ctggccgcataccaggcgcgcagcgtggacatcgacggctgcacgtaccgcgagggcttg
tcggccgtgcgcatcgacggcggggtggcgggcaacgtcattcccgatgcggccgcggtg
acggtcaacttccgctttgccccggaccggtcggcgcccgacgcgctgcaacacgtgcac
gacgtgctcgccggactggacgtgcacatcgaacagaccgacgccgcggccggggcgatg
cccgggctgtcccagcccgccgccaaggcgttggtcgaggcggcgggcggcaacgtgcgg
gccaagtacggctggaccgacgtcgcgcggttcgccgcgctgggtataccggcggtcaac
ttcggccccggcgacccgaatttggcgcaccggcgcgacgaacgcgtggcggtcgccaac
atcaccgcggcggtggacatgctgcgccgctacctggccggctag

DBGET integrated database retrieval system