KEGG   Mycobacterium sp. MOTT36Y: W7S_06560Help
Entry
W7S_06560         CDS       T02113                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
mmm  Mycobacterium sp. MOTT36Y
Pathway
mmm00260  Glycine, serine and threonine metabolism
mmm00750  Vitamin B6 metabolism
mmm01100  Metabolic pathways
mmm01110  Biosynthesis of secondary metabolites
mmm01120  Microbial metabolism in diverse environments
mmm01230  Biosynthesis of amino acids
Module
mmm_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mmm00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    W7S_06560
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    W7S_06560
Enzymes [BR:mmm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     W7S_06560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AFJ34295
UniProt: I2AAH1
Position
1360827..1361909
Genome map
AA seq 360 aa AA seqDB search
MSAPRTAVHQPWPGLIEAYRDRLPVGDDWTPVTLLEGGTPLIAATRLSEKTGCTVHLKVE
GLNPTGSFKDRGMTMAVTDAVARGQQAVLCASTGNTSASAAAYAARAGITCAVLIPQGKI
AMGKLAQAVMHGAKIIQIDGNFDDCLELARKMAADFPTISLVNSVNPVRIEGQKTAAFEI
VDALGAAPDVHALPVGNAGNITAYWKGYTEYHHEGLIEKLPRMLGTQAAGAAPLVNGAPV
KNPETIATAIRIGAPASWTAAVDAQRQSNGRFLAATDEEILAAYHLVAESEGVFVEPASA
ASIAGLLKAVDDGWVARGSTVVCTVTGNGLKDPDTALRDMPTVTALPVDPVLVVEKLGLA
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcgccgcgcaccgccgtccaccagccctggcccgggctcatcgaggcctaccgg
gaccggttgccggtgggcgacgactggaccccggtcaccctgctcgagggcggcaccccg
ctgatcgcggcgacccgcctgtcggaaaagaccggctgcacagtccatctcaaggtcgag
ggcctcaatcccaccggctccttcaaagaccgggggatgacgatggcggtcaccgatgcg
gtggcgcgcggccaacaggccgtgttgtgcgcctcgaccggcaacacctcggcgtcggcg
gcggcctatgccgcccgcgccgggatcacctgcgcggtgctgatcccgcagggcaagatc
gcgatgggcaagctggcgcaggcggtgatgcacggcgccaagatcatccagatcgacggc
aacttcgacgactgcctggaactggcccgaaagatggccgccgacttcccgacgatctcc
ttggtcaattcggtcaacccggtgcgcatcgagggccagaagacggccgcgttcgagatc
gtcgacgcgctcggcgcagcgccggacgtgcacgcccttccggtcggcaacgcgggcaac
atcaccgcgtactggaagggatacaccgagtatcaccacgagggcctgatcgaaaagctg
ccgcggatgctgggcacccaggcggccggcgcggcccccctggtgaacggtgcgccggtc
aagaacccggaaacgattgcgaccgcgatccgcatcggcgcgcccgcgtcgtggacggcc
gcggtcgacgcgcagcgccaatccaacggccgcttcctggcggccaccgacgaggagatc
ctggccgcctaccacctggtggccgagtccgaaggtgtcttcgtcgaacccgcctcggcg
gccagcatcgcgggtctgctcaaggccgtcgacgacggctgggtggcccgcgggtcgacg
gtcgtgtgcacggtgacgggcaacgggctcaaggatcccgacacggcactacgggatatg
cccaccgtgaccgcgctgccggttgatccggtcctggtcgtcgaaaaactggggctggcg
tag

DBGET integrated database retrieval system