KEGG   Mycobacterium sp. MOTT36Y: W7S_06560Help
Entry
W7S_06560         CDS       T02113                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mmm  Mycobacterium sp. MOTT36Y
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mmm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    W7S_06560
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    W7S_06560
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    W7S_06560
Enzymes [BR:mmm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     W7S_06560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1360827..1361909
Genome map
AA seq 360 aa AA seqDB search
MSAPRTAVHQPWPGLIEAYRDRLPVGDDWTPVTLLEGGTPLIAATRLSEKTGCTVHLKVE
GLNPTGSFKDRGMTMAVTDAVARGQQAVLCASTGNTSASAAAYAARAGITCAVLIPQGKI
AMGKLAQAVMHGAKIIQIDGNFDDCLELARKMAADFPTISLVNSVNPVRIEGQKTAAFEI
VDALGAAPDVHALPVGNAGNITAYWKGYTEYHHEGLIEKLPRMLGTQAAGAAPLVNGAPV
KNPETIATAIRIGAPASWTAAVDAQRQSNGRFLAATDEEILAAYHLVAESEGVFVEPASA
ASIAGLLKAVDDGWVARGSTVVCTVTGNGLKDPDTALRDMPTVTALPVDPVLVVEKLGLA
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcgccgcgcaccgccgtccaccagccctggcccgggctcatcgaggcctaccgg
gaccggttgccggtgggcgacgactggaccccggtcaccctgctcgagggcggcaccccg
ctgatcgcggcgacccgcctgtcggaaaagaccggctgcacagtccatctcaaggtcgag
ggcctcaatcccaccggctccttcaaagaccgggggatgacgatggcggtcaccgatgcg
gtggcgcgcggccaacaggccgtgttgtgcgcctcgaccggcaacacctcggcgtcggcg
gcggcctatgccgcccgcgccgggatcacctgcgcggtgctgatcccgcagggcaagatc
gcgatgggcaagctggcgcaggcggtgatgcacggcgccaagatcatccagatcgacggc
aacttcgacgactgcctggaactggcccgaaagatggccgccgacttcccgacgatctcc
ttggtcaattcggtcaacccggtgcgcatcgagggccagaagacggccgcgttcgagatc
gtcgacgcgctcggcgcagcgccggacgtgcacgcccttccggtcggcaacgcgggcaac
atcaccgcgtactggaagggatacaccgagtatcaccacgagggcctgatcgaaaagctg
ccgcggatgctgggcacccaggcggccggcgcggcccccctggtgaacggtgcgccggtc
aagaacccggaaacgattgcgaccgcgatccgcatcggcgcgcccgcgtcgtggacggcc
gcggtcgacgcgcagcgccaatccaacggccgcttcctggcggccaccgacgaggagatc
ctggccgcctaccacctggtggccgagtccgaaggtgtcttcgtcgaacccgcctcggcg
gccagcatcgcgggtctgctcaaggccgtcgacgacggctgggtggcccgcgggtcgacg
gtcgtgtgcacggtgacgggcaacgggctcaaggatcccgacacggcactacgggatatg
cccaccgtgaccgcgctgccggttgatccggtcctggtcgtcgaaaaactggggctggcg
tag

DBGET integrated database retrieval system