KEGG   Mycobacterium sp. MOTT36Y: W7S_09785Help
Entry
W7S_09785         CDS       T02113                                 

Definition
(GenBank) hypothetical protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mmm  Mycobacterium sp. MOTT36Y
Pathway
mmm00071  Fatty acid degradation
mmm00072  Synthesis and degradation of ketone bodies
mmm00280  Valine, leucine and isoleucine degradation
mmm00310  Lysine degradation
mmm00362  Benzoate degradation
mmm00380  Tryptophan metabolism
mmm00620  Pyruvate metabolism
mmm00630  Glyoxylate and dicarboxylate metabolism
mmm00640  Propanoate metabolism
mmm00650  Butanoate metabolism
mmm00900  Terpenoid backbone biosynthesis
mmm01100  Metabolic pathways
mmm01110  Biosynthesis of secondary metabolites
mmm01120  Microbial metabolism in diverse environments
mmm01130  Biosynthesis of antibiotics
mmm01200  Carbon metabolism
mmm01212  Fatty acid metabolism
mmm02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mmm00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    W7S_09785
   00630 Glyoxylate and dicarboxylate metabolism
    W7S_09785
   00640 Propanoate metabolism
    W7S_09785
   00650 Butanoate metabolism
    W7S_09785
  Lipid metabolism
   00071 Fatty acid degradation
    W7S_09785
   00072 Synthesis and degradation of ketone bodies
    W7S_09785
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    W7S_09785
   00310 Lysine degradation
    W7S_09785
   00380 Tryptophan metabolism
    W7S_09785
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    W7S_09785
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    W7S_09785
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    W7S_09785
Enzymes [BR:mmm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     W7S_09785
Exosome [BR:mmm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   W7S_09785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AFJ34932
UniProt: I2ACA8
Position
2120292..2121467
Genome map
AA seq 391 aa AA seqDB search
MGTPVIVGAVRTAIGRSFKGTLVNTPPETLITAVLPEVVRRSGVDPAAIDDIIFAESHYG
GGDLARYAATATGLEHVPGQSVNRHCAGSLTAIGNAAAQIGSGMERVLIAGGVQSLSMTP
LTNWRIPGPELKFEERWMPPTHVETPDAPAKDMSITVGWNTAQTVGITREEMDAWAARSH
QRAVAAQDAGKFVDEILPLKISQADGSVIEFAVDEHPRRDTTVEKLAGLKVLHPEIEGFS
ITAGNSSGTNDAAAAVALVDREYADAEKLNVMGTVRAWAAAGVPPRDCGLGAVKVIGKVL
QRAGLSPGDVALWEINEAFASVPIAACREYGLDEEKVNFSGSGCSLGHPIAASGARMVTT
LAYELARRGGGIGVAAMCAGGGQGGAVVIEV
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgggtacacccgtcatcgttggagccgtccgaacggcgatcggccgttccttcaagggg
acgctcgtcaacacgccacccgagacgctgatcaccgcggtgcttcccgaggtggtgcgc
cggtccggtgtggacccggccgccatcgacgacatcattttcgccgaatcccactacggg
ggcggcgatctcgctcggtatgcggccaccgcgaccggcctcgagcatgtccccggtcaa
tcggtcaaccggcattgcgcgggcagcctcaccgcgatcggcaacgcggcggcgcagatc
ggttccggcatggagcgggtgctgatcgccggcggcgtgcagtcgctgtcgatgacgccg
ctgaccaactggcgcatccccggacccgagctgaagttcgaggagcggtggatgccgccg
acgcacgtcgagacgcccgacgcgccggccaaggacatgtcgatcacggtcggctggaac
accgcccagaccgtcggcatcacgcgcgaggagatggacgcgtgggcggcccgctcgcat
cagcgcgccgtcgcggcccaggacgcgggcaagttcgtcgatgagatcctgcccctgaag
atttcgcaggcggacggttcggtcatcgagttcgccgtcgacgagcacccccgccgtgac
accaccgtcgaaaagctggccggcctcaaggtattgcaccccgagatcgagggcttctcg
atcacggcgggaaacagcagcggcaccaacgacgccgcggccgcggtcgcgctggtcgac
cgcgagtacgccgacgcggagaagctcaacgtgatgggcacggtcagggcgtgggccgcc
gcgggcgtgccgccacgggactgcggcctgggtgcggtcaaggtcatcggaaaggtgttg
cagcgcgccgggttgtcgcccggcgacgtggcgctgtgggagatcaacgaggcgttcgcg
tccgtgccgatcgcggcgtgccgggaatacggcctcgacgaggagaaggtgaacttctcc
ggtagcggctgcagcctgggccacccgatcgcggcctccggcgcgcgcatggtgaccacg
ctggcctacgagctggcccgccgcggcggcggcatcggcgtcgcggcgatgtgcgccggc
ggcggccagggcggcgctgtcgtcatcgaggtctag

DBGET integrated database retrieval system